Recombinant Mouse Il1a Protein, His-tagged

Cat.No. : Il1a-7236M
Product Overview : Recombinant mouse IL1a protein, fused to His-tag at N-terminus, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 115-270
Description : Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Form : Liquid
Molecular Mass : 20.4 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
Purity : > 85 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by Bradford assay)
Storage Buffer : Phosphate buffer saline (pH 7.4) containing 10 % glycerol.
Gene Name Il1a interleukin 1 alpha [ Mus musculus (house mouse) ]
Official Symbol Il1a
Synonyms Il1a; interleukin 1 alpha; Il; Il-1a; interleukin-1 alpha; IL-1 alpha
Gene ID 16175
mRNA Refseq NM_010554
Protein Refseq NP_034684
UniProt ID P01582

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il1a Products

Required fields are marked with *

My Review for All Il1a Products

Required fields are marked with *

0

Inquiry Basket

cartIcon