Recombinant Mouse Il1a Protein, His-tagged
| Cat.No. : | Il1a-7236M |
| Product Overview : | Recombinant mouse IL1a protein, fused to His-tag at N-terminus, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 115-270 |
| Description : | Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. |
| Form : | Liquid |
| Molecular Mass : | 20.4 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS |
| Purity : | > 85 % by SDS-PAGE |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : | 1.0 mg/mL (determined by Bradford assay) |
| Storage Buffer : | Phosphate buffer saline (pH 7.4) containing 10 % glycerol. |
| Gene Name | Il1a interleukin 1 alpha [ Mus musculus (house mouse) ] |
| Official Symbol | Il1a |
| Synonyms | Il1a; interleukin 1 alpha; Il; Il-1a; interleukin-1 alpha; IL-1 alpha |
| Gene ID | 16175 |
| mRNA Refseq | NM_010554 |
| Protein Refseq | NP_034684 |
| UniProt ID | P01582 |
| ◆ Recombinant Proteins | ||
| IL1A-622C | Active Recombinant Goat IL1A protein, His-tagged | +Inquiry |
| IL1a-640M | Recombinant Mouse interleukin 1, alpha, His-tagged | +Inquiry |
| Il1a-251I | Active Recombinant Rat Il1a Protein | +Inquiry |
| Il1a-306M | Active Recombinant Mouse Il1a protein | +Inquiry |
| Il1a-624G | Recombinant Guinea pig Il1a protein, His & S-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL1A-2911HCL | Recombinant Human IL1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il1a Products
Required fields are marked with *
My Review for All Il1a Products
Required fields are marked with *
