Recombinant Mouse Il1a Protein, His-tagged
Cat.No. : | Il1a-7236M |
Product Overview : | Recombinant mouse IL1a protein, fused to His-tag at N-terminus, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 115-270 |
Description : | Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. |
Form : | Liquid |
Molecular Mass : | 20.4 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS |
Purity : | > 85 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by Bradford assay) |
Storage Buffer : | Phosphate buffer saline (pH 7.4) containing 10 % glycerol. |
Gene Name | Il1a interleukin 1 alpha [ Mus musculus (house mouse) ] |
Official Symbol | Il1a |
Synonyms | Il1a; interleukin 1 alpha; Il; Il-1a; interleukin-1 alpha; IL-1 alpha |
Gene ID | 16175 |
mRNA Refseq | NM_010554 |
Protein Refseq | NP_034684 |
UniProt ID | P01582 |
◆ Recombinant Proteins | ||
IL1A-621D | Recombinant Dog IL1A protein, His & T7-tagged | +Inquiry |
Il1A-26682H | Active Recombinant Human Il1A, HIgG1 Fc-tagged | +Inquiry |
Il1a-6734M | Recombinant Mouse Il1a Protein (Ser115-Ser270) | +Inquiry |
IL1A-1399H | Recombinant Human IL1A protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
IL1α-81P | Recombinant Porcine Interleukin-1 alpha | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1A-2911HCL | Recombinant Human IL1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il1a Products
Required fields are marked with *
My Review for All Il1a Products
Required fields are marked with *
0
Inquiry Basket