Active Recombinant Human IL1B
Cat.No. : | IL1B-23H |
Product Overview : | Recombinant full length Human IL-1β MW=17 kDa. The recombinant protein was purified by Ni-NTA and followed gel filtration chromatography |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | IL1 is a name that designates two pleiotropic cytokines, IL-1α (IL1-F1) and IL-1β (IL-1F2), which are the products of distinct genes. IL-1α and IL-1β are structurally related polypeptides that share approximately 21% amino acid (aa) identity in human. Both proteins are produced by a wide variety of cells in response to inflammatory agents, infections, or microbial endotoxins. While IL-1α and IL-1β are regulated independently, they bind to the same receptor and exert identical biological effects. |
Form : | Lyophilized from a 0.22μm filtered solution at a concentration of 1mg/ml in 100mM Tris-HCl, pH8.0, 100mM NaCl, 1mM DTT. |
Bio-activity : | The recombinant protein was active in ELISA assay with an EC50 of about 5nM |
Molecular Mass : | The measured MW in LC-MS was 17422 Dalton, in agreement with its theoretic molecular weight |
AA Sequence : | GAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLK DDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTM QFVSS |
Purity : | Purity>95% by SDS PAGE and Coomassie blue stain |
Storage : | Upon reconstitution, the preparation is stable for up to 1 month at 2-8°C. For long term storage, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 1.0 mg/ml. |
Full Length : | Full L. |
Gene Name | IL1B interleukin 1, beta [ Homo sapiens ] |
Official Symbol | IL1B |
Synonyms | IL1B; interleukin 1, beta; interleukin-1 beta; IL 1B; IL1 BETA; IL1F2; IL-1 beta; catabolin; preinterleukin 1 beta; pro-interleukin-1-beta; IL-1; IL1-BETA; |
Gene ID | 3553 |
mRNA Refseq | NM_000576 |
Protein Refseq | NP_000567 |
MIM | 147720 |
UniProt ID | P01584 |
Chromosome Location | 2q14 |
Pathway | African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Apoptosis, organism-specific biosystem; |
Function | cytokine activity; cytokine activity; growth factor activity; interleukin-1 receptor binding; protein domain specific binding; |
◆ Recombinant Proteins | ||
IL1B-163P | Recombinant Active Pig IL1B Protein, His-tagged(C-ter) | +Inquiry |
IL1B-69H | Recombinant Human IL1B Protein | +Inquiry |
IL1B-2166C | Recombinant Cynomolgus IL1B protein, His-tagged | +Inquiry |
IL1B-920C | Active Recombinant Canine IL1B Protein (Ala115-Ser266) | +Inquiry |
IL1B-1024P | Recombinant Pig IL1B protein(Ala115-Pro267) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1B Products
Required fields are marked with *
My Review for All IL1B Products
Required fields are marked with *