Active Recombinant Human IL1B

• Cat.No.: IL1B-23H
• Product Overview: Recombinant full length Human IL-1β MW=17 kDa. The recombinant protein was purified by Ni-NTA and followed gel filtration chromatography

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: IL1 is a name that designates two pleiotropic cytokines, IL-1α (IL1-F1) and IL-1β (IL-1F2), which are the products of distinct genes. IL-1α and IL-1β are structurally related polypeptides that share approximately 21% amino acid (aa) identity in human. Both proteins are produced by a wide variety of cells in response to inflammatory agents, infections, or microbial endotoxins. While IL-1α and IL-1β are regulated independently, they bind to the same receptor and exert identical biological effects.
• Form: Lyophilized from a 0.22μm filtered solution at a concentration of 1mg/ml in 100mM Tris-HCl, pH8.0, 100mM NaCl, 1mM DTT.
• Bio-activity: The recombinant protein was active in ELISA assay with an EC50 of about 5nM
• Molecular Mass: The measured MW in LC-MS was 17422 Dalton, in agreement with its theoretic molecular weight
• AA Sequence: GAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLK DDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTM QFVSS
• Purity: Purity>95% by SDS PAGE and Coomassie blue stain
• Storage: Upon reconstitution, the preparation is stable for up to 1 month at 2-8°C. For long term storage, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 1.0 mg/ml.
• Full Length: Full L.

Gene Information

• Gene Name: IL1B interleukin 1, beta [ Homo sapiens ]
• Official Symbol: IL1B
• Synonyms: IL1B; interleukin 1, beta; interleukin-1 beta; IL 1B; IL1 BETA; IL1F2; IL-1 beta; catabolin; preinterleukin 1 beta; pro-interleukin-1-beta; IL-1; IL1-BETA
• Gene ID: 3553
• mRNA Refseq: NM_000576
• Protein Refseq: NP_000567
• MIM: 147720
• UniProt ID: P01584
• Chromosome Location: 2q14
• Pathway: African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Apoptosis, organism-specific biosystem
• Function: cytokine activity; cytokine activity; growth factor activity; interleukin-1 receptor binding; protein domain specific binding