Recombinant Mouse IL1RL2 Protein (22-338 aa), His-tagged
Cat.No. : | IL1RL2-1983M |
Product Overview : | Recombinant Mouse IL1RL2 Protein (22-338 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-338 aa |
Description : | Receptor for interleukin-36 (IL36A, IL36B and IL36G). After binding to interleukin-36 associates with the coreceptor IL1RAP to form the interleukin-36 receptor complex which mediates interleukin-36-dependent activation of NF-kappa-B, MAPK and other pathways. The IL-36 signaling system is thought to be present in epithelial barriers and to take part in local inflammatory response; it is similar to the IL-1 system. Seems to be involved in skin inflammatory response by induction of the IL-23/IL-17/IL-22 pathway. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 40.0 kDa |
AA Sequence : | DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCALDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Il1rl2 interleukin 1 receptor-like 2 [ Mus musculus ] |
Official Symbol | IL1RL2 |
Synonyms | IL1RL2; IL1R-rp2; AI481289; AW551444; IL-1Rrp2; |
Gene ID | 107527 |
mRNA Refseq | NM_133193 |
Protein Refseq | NP_573456 |
UniProt ID | Q9ERS7 |
◆ Recombinant Proteins | ||
IL1RL2-1983M | Recombinant Mouse IL1RL2 Protein (22-338 aa), His-tagged | +Inquiry |
IL1RL2-3036R | Recombinant Rat IL1RL2 Protein | +Inquiry |
IL1RL2-1639H | Recombinant Human Interleukin 1 Receptor-Like 2 | +Inquiry |
Il1rl2-8342R | Recombinant Rat Il1rl2 | +Inquiry |
IL1RL2-336H | Recombinant Human IL1RL2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1RL2 Products
Required fields are marked with *
My Review for All IL1RL2 Products
Required fields are marked with *
0
Inquiry Basket