Recombinant Mouse INS1 Protein (25-108 aa), His-Myc-tagged

Cat.No. : INS1-2164M
Product Overview : Recombinant Mouse INS1 Protein (25-108 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His&Myc
Protein Length : 25-108 aa
Description : Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 13.0 kDa
AA Sequence : FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Ins1 insulin I [ Mus musculus ]
Official Symbol INS1
Synonyms INS1; insulin I; insulin-1; Ins-1; Ins2-rs1;
Gene ID 16333
mRNA Refseq NM_008386
Protein Refseq NP_032412
UniProt ID P01325

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INS1 Products

Required fields are marked with *

My Review for All INS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon