Recombinant Mouse INS1 Protein, His/Myc-tagged
Cat.No. : | INS1-63M |
Product Overview : | Recombinant Mouse INS1 Protein, fused to His/Myc-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Description : | This gene encodes insulin, a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. The encoded precursor protein undergoes proteolytic cleavage to produce a disulfide-linked heterodimeric functional protein that is stored in secretory granules. An increase in blood glucose levels, among others, induces the release of insulin from the secretory granules. Mice deficient in the functional hormone encoded by this gene develop diabetes mellitus. |
Form : | PBS, pH 7.4. |
Molecular Mass : | 12 kDa |
AA Sequence : | MGHHHHHHHHHHFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCNEQKLISEEDL |
Endotoxin : | <1EU/ug by LAL. |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.7 mg/ml / 0.7 mg/ml |
Gene Name | Ins1 insulin I [ Mus musculus (house mouse) ] |
Official Symbol | INS1 |
Synonyms | Ins-1; Ins2-rs1 |
Gene ID | 16333 |
mRNA Refseq | NM_008386 |
Protein Refseq | NP_032412 |
UniProt ID | P01325 |
◆ Recombinant Proteins | ||
INS1-2436R | Recombinant Rat INS1 Protein (25-54 aa), His-SUMO-tagged | +Inquiry |
INS1-8233M | Recombinant Mouse INS1 Protein | +Inquiry |
INS1-63M | Recombinant Mouse INS1 Protein, His/Myc-tagged | +Inquiry |
INS1-2256M | Recombinant Mouse INS1 Protein (25-108 aa), His-Myc-tagged | +Inquiry |
INS1-2732R | Recombinant Rat INS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INS1 Products
Required fields are marked with *
My Review for All INS1 Products
Required fields are marked with *
0
Inquiry Basket