Recombinant Mouse INS1 Protein, His/Myc-tagged

Cat.No. : INS1-63M
Product Overview : Recombinant Mouse INS1 Protein, fused to His/Myc-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Description : This gene encodes insulin, a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. The encoded precursor protein undergoes proteolytic cleavage to produce a disulfide-linked heterodimeric functional protein that is stored in secretory granules. An increase in blood glucose levels, among others, induces the release of insulin from the secretory granules. Mice deficient in the functional hormone encoded by this gene develop diabetes mellitus.
Form : PBS, pH 7.4.
Molecular Mass : 12 kDa
AA Sequence : MGHHHHHHHHHHFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCNEQKLISEEDL
Endotoxin : <1EU/ug by LAL.
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.7 mg/ml / 0.7 mg/ml
Gene Name Ins1 insulin I [ Mus musculus (house mouse) ]
Official Symbol INS1
Synonyms Ins-1; Ins2-rs1
Gene ID 16333
mRNA Refseq NM_008386
Protein Refseq NP_032412
UniProt ID P01325

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INS1 Products

Required fields are marked with *

My Review for All INS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon