Recombinant Mouse IRF5 Protein (1-497 aa), His-SUMO-tagged
Cat.No. : | IRF5-585M |
Product Overview : | Recombinant Mouse IRF5 Protein (1-497 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-497 aa |
Description : | Transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection. Activated by TLR7 or TLR8 signaling. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 72.0 kDa |
AA Sequence : | MNHSAPGIPPPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFYIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFQLFYDGPRDMPPQPYKIYEVCSNGPAPTESQPTDDYVLGEEEEEEEEELQRMLPGLSITEPALPGPPNAPYSLPKEDTKWPPALQPPVGLGPPVPDPNLLAPPSGNPAGFRQLLPEVLEPGPLASSQPPTEPLLPDLLISPHMLPLTDLEIKFQYRGRAPRTLTISNPQGCRLFYSQLEATQEQVELFGPVTLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCALAHGSCPNPIQREVKTKLFSLEQFLNELILFQKGQTNTPPPFEIFFCFGEEWPDVKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDHMVEQFKELHHLWQSQQQLQPMVQAPPVAGLDASQGPWPMHPVGMQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Irf5 interferon regulatory factor 5 [ Mus musculus ] |
Official Symbol | IRF5 |
Synonyms | IRF5; IRF-5; mirf5; AW491843; |
Gene ID | 27056 |
mRNA Refseq | NM_001252382 |
Protein Refseq | NP_001239311 |
UniProt ID | P56477 |
◆ Recombinant Proteins | ||
IRF5-5037H | Recombinant Human IRF5 Protein, GST-tagged | +Inquiry |
Irf5-3576M | Recombinant Mouse Irf5 Protein, Myc/DDK-tagged | +Inquiry |
IRF5-002H | Recombinant Human IRF5 Protein, Myc/DDK-tagged | +Inquiry |
IRF5-2228H | Recombinant Human IRF5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IRF5-590H | Recombinant Human IRF5 protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF5-5164HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
IRF5-5163HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
IRF5-5162HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRF5 Products
Required fields are marked with *
My Review for All IRF5 Products
Required fields are marked with *
0
Inquiry Basket