Recombinant Mouse Isg15 protein, His-tagged
Cat.No. : | Isg15-886M |
Product Overview : | Recombinant Mouse Isg15 protein(Q64339)(1-155aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-155aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.9 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGG |
Gene Name | Isg15 ISG15 ubiquitin-like modifier [ Mus musculus ] |
Official Symbol | Isg15 |
Synonyms | ISG15; ISG15 ubiquitin-like modifier; ubiquitin-like protein ISG15; interferon-stimulated protein 15; ubiquitin cross-reactive protein; interferon-induced 15 kDa protein; interferon-induced 15-KDa protein; interferon-induced 17 kDa protein; interferon, alpha-inducible protein; interferon-stimulated protein (15 kDa); G1p2; IP17; Irfp; UCRP; IGI15; MGC18616; MGC103144; MGC130321; |
Gene ID | 100038882 |
mRNA Refseq | NM_015783 |
Protein Refseq | NP_056598 |
◆ Recombinant Proteins | ||
ISG15-2306R | Recombinant Rhesus monkey ISG15 Protein, His-tagged | +Inquiry |
ISG15-191H | Recombinant Human ISG15 protein(Met1-Gly157) | +Inquiry |
ISG15-431M | Recombinant Mouse ISG15 Protein, His-GFP-tagged | +Inquiry |
ISG15-3330H | Recombinant Human ISG15 Protein (Met1-Gly157), N-His tagged | +Inquiry |
ISG15-3329H | Recombinant Human ISG15 Protein (Gly2-Gly157), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ISG15-5152HCL | Recombinant Human ISG15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Isg15 Products
Required fields are marked with *
My Review for All Isg15 Products
Required fields are marked with *
0
Inquiry Basket