Recombinant Mouse Isg15 protein, His-tagged
| Cat.No. : | Isg15-4633M | 
| Product Overview : | Recombinant Mouse Isg15 protein(Q64339)(1-155aa), fused with C-terminal His tag, was expressed in HEK293. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Mouse | 
| Source : | HEK293 | 
| Tag : | His | 
| Protein Length : | 1-155aa | 
| Tag : | C-His | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 19.2 kDa | 
| Purity : | Greater than 85% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. | 
| AA Sequence : | MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGG | 
| Gene Name | Isg15 ISG15 ubiquitin-like modifier [ Mus musculus ] | 
| Official Symbol | Isg15 | 
| Synonyms | ISG15; ISG15 ubiquitin-like modifier; ubiquitin-like protein ISG15; interferon-stimulated protein 15; ubiquitin cross-reactive protein; interferon-induced 15 kDa protein; interferon-induced 15-KDa protein; interferon-induced 17 kDa protein; interferon, alpha-inducible protein; interferon-stimulated protein (15 kDa); G1p2; IP17; Irfp; UCRP; IGI15; MGC18616; MGC103144; MGC130321; | 
| Gene ID | 100038882 | 
| mRNA Refseq | NM_015783 | 
| Protein Refseq | NP_056598 | 
| ◆ Recombinant Proteins | ||
| Isg15-83H | Recombinant Human Isg15 protein | +Inquiry | 
| Isg15-1868M | Recombinant Mouse Isg15 protein, His-tagged | +Inquiry | 
| ISG15-28728TH | Recombinant Human ISG15 | +Inquiry | 
| ISG15-3422H | Recombinant Human ISG15 protein, His-tagged | +Inquiry | 
| Isg15-009M | Recombinant Mouse Isg15 Protein, MYC/DDK-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ISG15-5152HCL | Recombinant Human ISG15 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All Isg15 Products
Required fields are marked with *
My Review for All Isg15 Products
Required fields are marked with *
  
        
    
      
            