Recombinant Mouse ITM2B Protein, His-tagged
Cat.No. : | ITM2B-65M |
Product Overview : | Recombinant Mouse ITM2B Protein, fused to His-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Description : | Enables ATP binding activity. Acts upstream of or within extrinsic apoptotic signaling pathway in absence of ligand. Predicted to be located in Golgi-associated vesicle membrane and extracellular space. Predicted to be integral component of organelle membrane. Predicted to be active in Golgi apparatus and plasma membrane. Is expressed in central nervous system; pancreas epithelium; and retina. Used to study cerebral amyloid angiopathy. Human ortholog(s) of this gene implicated in ITM2B-related cerebral amyloid angiopathy 1 and ITM2B-related cerebral amyloid angiopathy 2. Orthologous to human ITM2B (integral membrane protein 2B). |
Form : | Supplied as a 0.2 μm filtered solution in PBS , pH7.4. |
Molecular Mass : | ~24.9 kDa |
AA Sequence : | MHSSALLCCLVLLTGVRAYKYFALQPDDVYYCGLKYIKDDVILNEPSADAPAARYQTIEENIKIFEEDAVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPKNLLELLINIKAGTYLPQSYLIHEHMVITDRIENVDNLGFFIYRLCHDKETYKLQRRETIRGIQKREASNCFTIRHFENKFAVETLICSHHHHHH |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.1 mg/mL |
Gene Name | Itm2b integral membrane protein 2B [ Mus musculus (house mouse) ] |
Official Symbol | ITM2B |
Synonyms | Bri; Bri2; E25BMM; imBRI2; Bricd2b; D14Sel6; AI256040 |
Gene ID | 16432 |
mRNA Refseq | NM_008410 |
Protein Refseq | NP_032436 |
UniProt ID | O89051 |
◆ Recombinant Proteins | ||
ITM2B-6642C | Recombinant Chicken ITM2B | +Inquiry |
ITM2B-4650M | Recombinant Mouse ITM2B Protein, His (Fc)-Avi-tagged | +Inquiry |
Itm2b-3616M | Recombinant Mouse Itm2b Protein, Myc/DDK-tagged | +Inquiry |
ITM2B-2320R | Recombinant Rhesus monkey ITM2B Protein, His-tagged | +Inquiry |
ITM2B-4954H | Recombinant Human ITM2B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITM2B-5117HCL | Recombinant Human ITM2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITM2B Products
Required fields are marked with *
My Review for All ITM2B Products
Required fields are marked with *
0
Inquiry Basket