Recombinant Mouse ITM2B Protein, His-tagged

• Cat.No.: ITM2B-65M
• Product Overview: Recombinant Mouse ITM2B Protein, fused to His-tag, was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Description: Enables ATP binding activity. Acts upstream of or within extrinsic apoptotic signaling pathway in absence of ligand. Predicted to be located in Golgi-associated vesicle membrane and extracellular space. Predicted to be integral component of organelle membrane. Predicted to be active in Golgi apparatus and plasma membrane. Is expressed in central nervous system; pancreas epithelium; and retina. Used to study cerebral amyloid angiopathy. Human ortholog(s) of this gene implicated in ITM2B-related cerebral amyloid angiopathy 1 and ITM2B-related cerebral amyloid angiopathy 2. Orthologous to human ITM2B (integral membrane protein 2B).
• Form: Supplied as a 0.2 μm filtered solution in PBS , pH7.4.
• Molecular Mass: ~24.9 kDa
• AA Sequence: MHSSALLCCLVLLTGVRAYKYFALQPDDVYYCGLKYIKDDVILNEPSADAPAARYQTIEENIKIFEEDAVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPKNLLELLINIKAGTYLPQSYLIHEHMVITDRIENVDNLGFFIYRLCHDKETYKLQRRETIRGIQKREASNCFTIRHFENKFAVETLICSHHHHHH
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.1 mg/mL

Gene Information

• Gene Name: Itm2b integral membrane protein 2B [ Mus musculus (house mouse) ]
• Official Symbol: ITM2B
• Synonyms: Bri; Bri2; E25BMM; imBRI2; Bricd2b; D14Sel6; AI256040
• Gene ID: 16432
• mRNA Refseq: NM_008410
• Protein Refseq: NP_032436
• UniProt ID: O89051