Recombinant Mouse ITM2B Protein, His-tagged

Cat.No. : ITM2B-65M
Product Overview : Recombinant Mouse ITM2B Protein, fused to His-tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Description : Enables ATP binding activity. Acts upstream of or within extrinsic apoptotic signaling pathway in absence of ligand. Predicted to be located in Golgi-associated vesicle membrane and extracellular space. Predicted to be integral component of organelle membrane. Predicted to be active in Golgi apparatus and plasma membrane. Is expressed in central nervous system; pancreas epithelium; and retina. Used to study cerebral amyloid angiopathy. Human ortholog(s) of this gene implicated in ITM2B-related cerebral amyloid angiopathy 1 and ITM2B-related cerebral amyloid angiopathy 2. Orthologous to human ITM2B (integral membrane protein 2B).
Form : Supplied as a 0.2 μm filtered solution in PBS , pH7.4.
Molecular Mass : ~24.9 kDa
AA Sequence : MHSSALLCCLVLLTGVRAYKYFALQPDDVYYCGLKYIKDDVILNEPSADAPAARYQTIEENIKIFEEDAVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPKNLLELLINIKAGTYLPQSYLIHEHMVITDRIENVDNLGFFIYRLCHDKETYKLQRRETIRGIQKREASNCFTIRHFENKFAVETLICSHHHHHH
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.1 mg/mL
Gene Name Itm2b integral membrane protein 2B [ Mus musculus (house mouse) ]
Official Symbol ITM2B
Synonyms Bri; Bri2; E25BMM; imBRI2; Bricd2b; D14Sel6; AI256040
Gene ID 16432
mRNA Refseq NM_008410
Protein Refseq NP_032436
UniProt ID O89051

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITM2B Products

Required fields are marked with *

My Review for All ITM2B Products

Required fields are marked with *

0
cart-icon