Recombinant Mouse Itpr3 protein, Avi-tagged, Biotinylated

• Cat.No.: Itpr3-5105M
• Product Overview: Biotinylated Recombinant Mouse Itpr3 protein(P70227)(2517-2670 aa), fused with Avi tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Avi
• Protein Length: 2517-2670 aa
• Conjugation/Label: Biotin
• Form: Tris/PBS-based buffer, 6% Trehalose.
• AASequence: DTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRV KNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSGEGEGEQNEIRILQEKLGSTMKLVS HLTSQLNELKEQMTEQRKRRQRLGFVDVQNCMSR
• Purity: >85% (SDS-PAGE)
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• Conjugation: Biotin

Gene Information

• Gene Name: Itpr3 inositol 1,4,5-triphosphate receptor 3 [ Mus musculus ]
• Official Symbol: Itpr3
• Synonyms: ITPR3; inositol 1,4,5-triphosphate receptor 3; inositol 1,4,5-trisphosphate receptor type 3; IP3R 3; insP3R3; IP3 receptor; type 3 InsP3 receptor; type 3 inositol 1,4,5-trisphosphate receptor; Ip3r3; Itpr-3
• Gene ID: 16440
• mRNA Refseq: NM_080553
• Protein Refseq: NP_542120