Recombinant Mouse Itpr3 protein

Cat.No. : Itpr3-5103M
Product Overview : Recombinant Mouse Itpr3 protein(P70227)(2517-2670 aa) was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : Non
Protein Length : 2517-2670 aa
Form : Tris/PBS-based buffer, 6% Trehalose.
AASequence : DTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRV KNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSGEGEGEQNEIRILQEKLGSTMKLVS HLTSQLNELKEQMTEQRKRRQRLGFVDVQNCMSR
Purity : >85% (SDS-PAGE)
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. 
Gene Name Itpr3 inositol 1,4,5-triphosphate receptor 3 [ Mus musculus ]
Official Symbol Itpr3
Synonyms ITPR3; inositol 1,4,5-triphosphate receptor 3; inositol 1,4,5-trisphosphate receptor type 3; IP3R 3; insP3R3; IP3 receptor; type 3 InsP3 receptor; type 3 inositol 1,4,5-trisphosphate receptor; Ip3r3; Itpr-3;
Gene ID 16440
mRNA Refseq NM_080553
Protein Refseq NP_542120

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Itpr3 Products

Required fields are marked with *

My Review for All Itpr3 Products

Required fields are marked with *

0
cart-icon