Recombinant Mouse Jak1 protein, His-tagged
Cat.No. : | Jak1-3127M |
Product Overview : | Recombinant Mouse Jak1 protein(P52332)(848-1152aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 848-1152aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.1 kDa |
AA Sequence : | EEQNPDIVSEKQPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICMEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDFSPMALFLKMIGPTHGQMTVTRLVKTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTTFQNLIEGFEALL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Jak1 Janus kinase 1 [ Mus musculus ] |
Official Symbol | Jak1 |
Synonyms | JAK1; Janus kinase 1; tyrosine-protein kinase JAK1; JAK-1; AA960307; C130039L05Rik; MGC37919; |
Gene ID | 16451 |
mRNA Refseq | NM_146145 |
Protein Refseq | NP_666257 |
◆ Recombinant Proteins | ||
JAK1-160H | Recombinant Human JAK1 protein, His/MBP-tagged | +Inquiry |
JAK1-159H | Recombinant Human JAK1 protein, His/MBP-tagged | +Inquiry |
JAK1-2326R | Recombinant Rhesus monkey JAK1 Protein, His-tagged | +Inquiry |
JAK1-151H | Recombinant Human JAK1 Protein, DYKDDDDK-tagged | +Inquiry |
JAK1-3126H | Recombinant Human JAK1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JAK1-5107HCL | Recombinant Human JAK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Jak1 Products
Required fields are marked with *
My Review for All Jak1 Products
Required fields are marked with *
0
Inquiry Basket