Recombinant Mouse Khk protein, His-tagged
Cat.No. : | Khk-3135M |
Product Overview : | Recombinant Mouse Khk protein(P97328)(1-298aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-298aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.4kDa |
AA Sequence : | MEEKQILCVGLVVLDIINVVDKYPEEDTDRRCLSQRWQRGGNASNSCTVLSLLGARCAFMGSLAPGHVADFLVADFRQRGVDVSQVTWQSQGDTPCSCCIVNNSNGSRTIILYDTNLPDVSAKDFEKVDLTRFKWIHIEGRNASEQVKMLQRIEEHNAKQPLPQKVRVSVEIEKPREELFQLFSYGEVVFVSKDVAKHLGFQPAVEALRGLYSRVKKGATLVCAWAEEGADALGPDGQLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSKGNSMQEALRFGCQVAGKKCGLQGFDGIV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Khk ketohexokinase [ Mus musculus ] |
Official Symbol | Khk |
Synonyms | KHK; ketohexokinase; hepatic fructokinase; |
Gene ID | 16548 |
mRNA Refseq | NM_008439 |
Protein Refseq | NP_032465 |
◆ Recombinant Proteins | ||
Khk-1263M | Recombinant Mouse Khk Protein, MYC/DDK-tagged | +Inquiry |
KHK-905H | Recombinant Human Ketohexokinase (fructokinase) | +Inquiry |
KHK-29893TH | Recombinant Human KHK | +Inquiry |
KHK-450H | Active Recombinant Human KHK, His-tagged | +Inquiry |
KHK-151H | Recombinant Human KHK protein, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KHK-4985HCL | Recombinant Human KHK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Khk Products
Required fields are marked with *
My Review for All Khk Products
Required fields are marked with *