Recombinant Mouse Klk14 protein, His-tagged
Cat.No. : | Klk14-4610M |
Product Overview : | Recombinant Mouse Klk14 protein(Q8CGR5)(24-250aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-250aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.5 kDa |
AA Sequence : | IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQSN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Klk14 kallikrein related-peptidase 14 [ Mus musculus ] |
Official Symbol | Klk14 |
Synonyms | KLK14; kallikrein related-peptidase 14; kallikrein-14; mGK14; kallikrein 14; glandular kallikrein KLK14; GK14; MGC157618; |
Gene ID | 317653 |
mRNA Refseq | NM_174866 |
Protein Refseq | NP_777355 |
◆ Recombinant Proteins | ||
KLK14-2193M | Recombinant Mouse KLK14 Protein (24-250 aa), His-SUMO-tagged | +Inquiry |
KLK14-3231H | Recombinant Human KLK14 Protein, His (Fc)-Avi-tagged | +Inquiry |
Klk14-4610M | Recombinant Mouse Klk14 protein, His-tagged | +Inquiry |
KLK14-274H | Active Recombinant Human KLK14 protein, His-tagged | +Inquiry |
KLK14-4867M | Recombinant Mouse KLK14 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK14-4902HCL | Recombinant Human KLK14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Klk14 Products
Required fields are marked with *
My Review for All Klk14 Products
Required fields are marked with *
0
Inquiry Basket