Recombinant Mouse KLK1B22 Protein (25-259 aa), His-SUMO-tagged
Cat.No. : | KLK1B22-896M |
Product Overview : | Recombinant Mouse KLK1B22 Protein (25-259 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 25-259 aa |
Description : | Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 41.8 kDa |
AA Sequence : | ILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
UniProt ID | P15948 |
◆ Recombinant Proteins | ||
KLK1B22-8744M | Recombinant Mouse KLK1B22 Protein | +Inquiry |
KLK1B22-4871M | Recombinant Mouse KLK1B22 Protein, His (Fc)-Avi-tagged | +Inquiry |
Klk1b22-339M | Recombinant Mouse Klk1b22 Protein, His-tagged | +Inquiry |
KLK1B22-896M | Recombinant Mouse KLK1B22 Protein (25-259 aa), His-SUMO-tagged | +Inquiry |
KLK1B22-373M | Recombinant Mouse KLK1B22 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLK1B22 Products
Required fields are marked with *
My Review for All KLK1B22 Products
Required fields are marked with *
0
Inquiry Basket