"Lcn2" Related Products

Expand
Expand

Recombinant Mouse Lcn2 protein, Fc-tagged

Cat.No.: Lcn2-3272M
Product Overview: Recombinant Mouse Lcn2(Gln21-Asn200) fused with Fc tag at C-terminal was expressed in HEK293.
Description: Lipocalin-2, also known as Neutrophil Gelatinase-Associated Lipocalin (NGAL), is a secretory protein of the lipocalin superfamily. Lipocalin-2 contains a signal peptide that enables it to be secreted and form complexes with matrix metalloproteinase-9 (MMP-9) through disulfide bonds. Similar to other lipocalin family members, Lipocalin-2 is involved in diverse cellular processes, including the transport of small hydrophobic molecules, protection of MMP-9 from proteolytic degradation, and cell signaling. Furthermore, Lipocalin-2 can tightly bind to bacterial siderophore through a cell surface receptor, possibly serving as a potent bacteriostatic agent by sequestering iron, regulating innate immunity and protecting kidney epithelial cells from ischemia–reperfusion injury. This protein is mainly expressed in neutrophils and in lower levels in the kidney, prostate, and epithelia of the respiratory and alimentary tracts.Recent evidence also suggests its role as a biomarker for renal injury and inflammation.
Source: HEK293
Species: Mouse
Tag : Fc
Form: Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, 10% Glycerol, pH 5.5.
Protein length: Gln21-Asn200
AA Sequence: QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYN VTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSE NKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDNVDDIEGRMDEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Store at < -20 centigrade, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Shipping: The product is shipped on dry ice/ice packs.
Gene Name: Lcn2 lipocalin 2 [ Mus musculus ]
Official Symbol: Lcn2
Synonyms: LCN2; lipocalin 2; neutrophil gelatinase-associated lipocalin; p25; lipocalin-2; SV-40-induced 24P3 protein; secreted inducible protein 24; 24p3; Sip24; AW212229;
Gene ID: 16819
mRNA Refseq: NM_008491
Protein Refseq: NP_032517
UniProt ID: P11672
Chromosome Location: 2 B; 2 22.09 cM
Function: binding; iron ion binding; protease binding; protein binding; protein homodimerization activity; transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.