Recombinant Mouse Lefty2 protein, His&Myc-tagged
Cat.No. : | Lefty2-3162M |
Product Overview : | Recombinant Mouse Lefty2 protein(P57785)(78-368aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 78-368aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.1 kDa |
AA Sequence : | FSQNFREVAGRFLMSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRFERLSPHSARARVTIEWLRVREDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSAHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEVPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTIGWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRGIDL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Lefty2 left-right determination factor 2 [ Mus musculus ] |
Official Symbol | Lefty2 |
Synonyms | LEFTY2; left-right determination factor 2; protein lefty-2; protein lefty-B; left-right determination factor B; left-right determination, factor A; endometrial bleeding associated factor; Ebaf; Lefta; Leftb; AV214969; 6030463A22Rik; MGC98569; |
Gene ID | 320202 |
mRNA Refseq | NM_177099 |
Protein Refseq | NP_796073 |
◆ Recombinant Proteins | ||
LEFTY2-002H | Recombinant Human LEFTY2 Protein, C-His tagged | +Inquiry |
Lefty2-7973M | Recombinant Mouse Lefty2 protein, His-tagged | +Inquiry |
LEFTY2-799H | Recombinant Human LEFTY2 protein(Phe78-Pro366), hFc-tagged | +Inquiry |
LEFTY2-6328C | Recombinant Chicken LEFTY2 | +Inquiry |
LEFTY2-501H | Recombinant Human LEFTY2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LEFTY2-2779HCL | Recombinant Human LEFTY2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lefty2 Products
Required fields are marked with *
My Review for All Lefty2 Products
Required fields are marked with *