Recombinant Mouse Lefty2 protein, His&Myc-tagged

• Cat.No.: Lefty2-3162M
• Product Overview: Recombinant Mouse Lefty2 protein(P57785)(78-368aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 78-368aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 40.1 kDa
• AA Sequence: FSQNFREVAGRFLMSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRFERLSPHSARARVTIEWLRVREDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSAHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEVPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTIGWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRGIDL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Lefty2 left-right determination factor 2 [ Mus musculus ]
• Official Symbol: Lefty2
• Synonyms: LEFTY2; left-right determination factor 2; protein lefty-2; protein lefty-B; left-right determination factor B; left-right determination, factor A; endometrial bleeding associated factor; Ebaf; Lefta; Leftb; AV214969; 6030463A22Rik; MGC98569
• Gene ID: 320202
• mRNA Refseq: NM_177099
• Protein Refseq: NP_796073