Recombinant Mouse Lilrb3 protein, His-tagged
Cat.No. : | Lilrb3-5332M |
Product Overview : | Recombinant Mouse Lilrb3 protein(P97484)(25-642aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | 25-642aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 70.8 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SLPKPILRVQPDSVVSRRTKVTFLCEETIGANEYRLYKDGKLYKTVTKNKQKPENKAEFSFSNVDLSNAGQYRCSYSTQYKSSGYSDLLELVVTGHYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGSVITSKRAMTIWCQGNLDAEVYFLHNEKSQKTQSTQTLQEPGNKGKFFIPSVTLQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEYYEPRLSVLPSPVVTAGGNMTLHCASDFPYDKFILTKEDKKFGNSLDTEHISSSGQYRALFIIGPTTPTHTGAFRCYGYYKNAPQLWSVPSALQQILISGLSKKPSLLTHQGHILDPGMTLTLQCFSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVQPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQDSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMYLK |
Gene Name | Lilrb3 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3 [ Mus musculus ] |
Official Symbol | Lilrb3 |
Synonyms | LILRB3; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3; leukocyte immunoglobulin-like receptor subfamily B member 3; cell-surface glycoprotein p91; paired immunoglobulin-like receptor B; leukocyte immunoglobulin-like receptor 3; Gp91; Pirb; LIR-3; PIR-B; |
Gene ID | 18733 |
mRNA Refseq | NM_011095 |
Protein Refseq | NP_035225 |
◆ Recombinant Proteins | ||
LILRB3-1445M | Recombinant Mouse LILRB3 Protein (664-841 aa), His-tagged | +Inquiry |
LILRB3-535H | Recombinant Human LILRB3 Protein (Met1-Glu443), His-tagged, Biotinylated | +Inquiry |
LILRB3-199H | Recombinant Human LILRB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LILRB3-356H | Recombinant Human LILRB3 Protein, Fc-tagged | +Inquiry |
LILRB3-3356H | Recombinant Human LILRB3 protein(Met1-Glu443), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRB3-2208HCL | Recombinant Human LILRB3 cell lysate | +Inquiry |
LILRB3-1653MCL | Recombinant Mouse LILRB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lilrb3 Products
Required fields are marked with *
My Review for All Lilrb3 Products
Required fields are marked with *