Recombinant Rat LUM Protein (19-338 aa), His-tagged
| Cat.No. : | LUM-1936R |
| Product Overview : | Recombinant Rat LUM Protein (19-338 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 19-338 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 40.5 kDa |
| AA Sequence : | QYYDYDAPLFMYGELSPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLANNKISKLGSFDGLVNLTFIYLQHNQLKEEAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKITNIPDEYFNRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNKLEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Lum lumican [ Rattus norvegicus ] |
| Official Symbol | LUM |
| Synonyms | LUM; lumican; KSPG lumican; keratan sulfate proteoglycan lumican; |
| Gene ID | 81682 |
| mRNA Refseq | NM_031050 |
| Protein Refseq | NP_112312 |
| UniProt ID | P51886 |
| ◆ Recombinant Proteins | ||
| LUM-154H | Recombinant Human LUM protein, His-tagged | +Inquiry |
| LUM-822H | Recombinant Human LUM Protein, His-tagged | +Inquiry |
| LUM-3160R | Recombinant Rat LUM Protein, His (Fc)-Avi-tagged | +Inquiry |
| LUM-4470H | Recombinant Human LUM Protein (Gln19-Asn338), C-His tagged | +Inquiry |
| LUM-290HF | Recombinant Full Length Human LUM Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LUM-2210HCL | Recombinant Human LUM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LUM Products
Required fields are marked with *
My Review for All LUM Products
Required fields are marked with *



