Recombinant Mouse Ly6g protein, His-tagged
Cat.No. : | Ly6g-3995M |
Product Overview : | Recombinant Mouse Ly6g protein(P35461)(27-119aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-119aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 13.4 kDa |
AA Sequence : | LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Ly6g lymphocyte antigen 6 complex, locus G [ Mus musculus ] |
Official Symbol | Ly6g |
Synonyms | LY6G; lymphocyte antigen 6 complex, locus G; Gr1; Gr-1; Ly-6G; |
Gene ID | 17072 |
◆ Recombinant Proteins | ||
Ly6g-5640M | Recombinant Mouse Ly6g protein, His-sumostar-tagged | +Inquiry |
LY6G-2293M | Recombinant Mouse LY6G Protein (4--96 aa), His-tagged | +Inquiry |
Ly6g-3995M | Recombinant Mouse Ly6g protein, His-tagged | +Inquiry |
LY6G-2281M | Recombinant Mouse LY6G Protein (4-96 aa), His-tagged | +Inquiry |
Ly6g-5639M | Recombinant Mouse Ly6g protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ly6g Products
Required fields are marked with *
My Review for All Ly6g Products
Required fields are marked with *