Recombinant Mouse Ly96 protein, His-SUMO-tagged
Cat.No. : | Ly96-3193M |
Product Overview : | Recombinant Mouse Ly96 protein(Q9JHF9)(19-160aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 19-160aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.4 kDa |
AA Sequence : | EKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Ly96 lymphocyte antigen 96 [ Mus musculus ] |
Official Symbol | Ly96 |
Synonyms | LY96; lymphocyte antigen 96; ly-96; protein MD-2; myeloid differentiation factor-2; myeloid differentiation protein-2; MD2; MD-2; ESOP-1; MGC151162; |
Gene ID | 17087 |
mRNA Refseq | NM_001159711 |
Protein Refseq | NP_001153183 |
◆ Recombinant Proteins | ||
LY96-0381H | Recombinant Human LY96 Protein (Gln19-Asn160), C-His-tagged | +Inquiry |
LY96-4158H | Recombinant Human LY96 Protein (Met1-Asn160), C-His tagged | +Inquiry |
Ly96-5036M | Recombinant Mouse Ly96 protein, Flag-Myc-tagged | +Inquiry |
LY96-154H | Recombinant Human LY96, GST-tagged | +Inquiry |
LY96-4157H | Recombinant Human LY96 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY96-771MCL | Recombinant Mouse LY96 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ly96 Products
Required fields are marked with *
My Review for All Ly96 Products
Required fields are marked with *