Recombinant Mouse Lysmd3 protein, His&Myc-tagged
Cat.No. : | Lysmd3-5342M |
Product Overview : | Recombinant Mouse Lysmd3 protein(Q99LE3)(1-216aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-216a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MAGRNQNRTVSLPGIQASGHVLAFGNCTDNDMLEEDAEVYELRSRGKEKVRRSASRDRLDDIVILTKDIQEGDTLNAVALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKRFSSLTETLHPLKGRHILHPPPVPYFQEQDIVPADGSLSSSESAGSFLKEVDRDIEQIVKCTDTKKENLNEVVSALTAQQVRFEPDNKSIHRKDPYYGADWGIG |
◆ Recombinant Proteins | ||
LYSMD3-6036HF | Recombinant Full Length Human LYSMD3 Protein, GST-tagged | +Inquiry |
LYSMD3-3065C | Recombinant Chicken LYSMD3 | +Inquiry |
LYSMD3-3522R | Recombinant Rat LYSMD3 Protein | +Inquiry |
LYSMD3-3178R | Recombinant Rat LYSMD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYSMD3-5276M | Recombinant Mouse LYSMD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lysmd3 Products
Required fields are marked with *
My Review for All Lysmd3 Products
Required fields are marked with *