Recombinant Mouse Mb protein, His&Myc-tagged
| Cat.No. : | Mb-3210M |
| Product Overview : | Recombinant Mouse Mb protein(P04247)(2-154aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 2-154aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 21.9 kDa |
| AA Sequence : | GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Mb myoglobin [ Mus musculus ] |
| Official Symbol | Mb |
| Synonyms | MB; myoglobin; AI325109; |
| Gene ID | 17189 |
| mRNA Refseq | NM_001164047 |
| Protein Refseq | NP_001157519 |
| ◆ Recombinant Proteins | ||
| MB-9596M | Recombinant Mouse MB Protein | +Inquiry |
| MB-4027C | Recombinant Chicken MB | +Inquiry |
| MB-3601R | Recombinant Rat MB Protein | +Inquiry |
| MB-0028H | Recombinant Human MB Protein | +Inquiry |
| MB-532C | Recombinant Cynomolgus monkey MB protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| MB-8226H | Native Human Heart Myoglobin | +Inquiry |
| Mb-160M | Native Mouse Mb | +Inquiry |
| MB-30275TH | Native Human MB | +Inquiry |
| MB-236B | Native Bovine Myoglobin | +Inquiry |
| Mb-8232R | Native Rat Myoglobin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MB-4446HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
| MB-4445HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mb Products
Required fields are marked with *
My Review for All Mb Products
Required fields are marked with *
