Recombinant Human MB protein(21-100 aa), C-His-tagged
| Cat.No. : | MB-2522H |
| Product Overview : | Recombinant Human MB protein(P02144)(21-100 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 21-100 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 11 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | DIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKI |
| Gene Name | MB myoglobin [ Homo sapiens ] |
| Official Symbol | MB |
| Synonyms | MB; myoglobin; PVALB; MGC13548; |
| Gene ID | 4151 |
| mRNA Refseq | NM_005368 |
| Protein Refseq | NP_005359 |
| MIM | 160000 |
| UniProt ID | P02144 |
| ◆ Recombinant Proteins | ||
| MB-745D | Recombinant Dog MB protein, His-tagged | +Inquiry |
| MB-10864Z | Recombinant Zebrafish MB | +Inquiry |
| MB-30278TH | Recombinant Human MB, His-tagged | +Inquiry |
| MB-3601R | Recombinant Rat MB Protein | +Inquiry |
| MB-5391M | Recombinant Mouse MB Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| Mb-8229M | Native Mouse Myoglobin | +Inquiry |
| MB-30275TH | Native Human MB | +Inquiry |
| MB-8227H | Native Human Heart Myoglobin | +Inquiry |
| MB-237C | Native Dog Myoglobin | +Inquiry |
| Mb-160M | Native Mouse Mb | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MB-4445HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
| MB-4446HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MB Products
Required fields are marked with *
My Review for All MB Products
Required fields are marked with *
