Recombinant Mouse Neu1 protein, His-tagged
Cat.No. : | Neu1-3272M |
Product Overview : | Recombinant Mouse Neu1 protein(O35657)(42-409aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 42-409aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 46.3 kDa |
AA Sequence : | EDDFSLVQPLVTMEQLLWVSGKQIGSVDTFRIPLITATPRGTLLAFAEARKKSASDEGAKFIAMRRSTDQGSTWSSTAFIVDDGEASDGLNLGAVVNDVDTGIVFLIYTLCAHKVNCQVASTMLVWSKDDGISWSPPRNLSVDIGTEMFAPGPGSGIQKQREPGKGRLIVCGHGTLERDGVFCLLSDDHGASWHYGTGVSGIPFGQPKHDHDFNPDECQPYELPDGSVIINARNQNNYHCRCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGALATSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWQKERVQVWPGPSGYSSLTALENSTDGKKQPPQLFVLYEKGLNRYTESISMVKISVYGTL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Neu1 neuraminidase 1 [ Mus musculus ] |
Official Symbol | Neu1 |
Synonyms | NEU1; neuraminidase 1; sialidase-1; sialidase 1; G9 sialidase; lysosomal sialidase; HLA-B-associated transcript 7; N-acetyl-alpha-neuraminidase 1; G9; Apl; Neu; Aglp; Bat7; Bat-7; Map-2; Neu-1; AA407268; AA407316; |
Gene ID | 18010 |
mRNA Refseq | NM_010893 |
Protein Refseq | NP_035023 |
◆ Recombinant Proteins | ||
NEU1-156H | Recombinant Human NEU1, His-tagged | +Inquiry |
NEU1-4014Z | Recombinant Zebrafish NEU1 | +Inquiry |
NEU1-4686H | Recombinant Human NEU1 Protein (Ala47-Leu415), C-His tagged | +Inquiry |
NEU1-1501H | Recombinant Human NEU1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NEU1-5667H | Recombinant Human NEU1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEU1-3871HCL | Recombinant Human NEU1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Neu1 Products
Required fields are marked with *
My Review for All Neu1 Products
Required fields are marked with *