Recombinant Mouse neuregulin 4 Protein, His tagged
| Cat.No. : | Nrg4-02M |
| Product Overview : | Recombinant Mouse Nrg4 Protein with C-His tag was expressed in E. coli. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-62 aa |
| Description : | Enables receptor ligand activity. Involved in ERBB4-ERBB4 signaling pathway. Is active in extracellular space. Is expressed in several structures, including embryo mesenchyme; integumental system; pancreas; surface ectoderm; and uterus. Orthologous to human NRG4 (neuregulin 4). |
| Tag : | C-His |
| Molecular Mass : | 8 kDa |
| AA Sequence : | MPTDHEQPCGPRHRSFCLNGGICYVIPTIPSPFCRCIENYTGARCEEVFLPSSSIPSESNLSHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 95% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Lyophilized from Sterile PBS, pH7.4, 0.1% SKL, 5% Trehalose, 5% Mannitol |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.1 mg/mL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents. |
| Gene Name | Nrg4 neuregulin 4 [ Mus musculus (house mouse) ] |
| Official Symbol | Nrg4 |
| Synonyms | NRG4; neuregulin 4; pro-neuregulin-4, membrane-bound isoform; pro-NRG4; AI552600 |
| Gene ID | 83961 |
| mRNA Refseq | NM_032002 |
| Protein Refseq | NP_114391 |
| UniProt ID | Q9WTX4 |
| ◆ Recombinant Proteins | ||
| NRG4-167 | Recombinant NRG4 Protein, GST-tagged | +Inquiry |
| NRG4-15H | Active Recombinant Human NRG4 Protein, GST tagged | +Inquiry |
| NRG4-09H | Recombinant Human NRG4 Protein | +Inquiry |
| NRG4-3679H | Recombinant Human NRG4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NRG4-07H | Active Recombinant Human NRG4 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NRG4-1221HCL | Recombinant Human NRG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Nrg4 Products
Required fields are marked with *
My Review for All Nrg4 Products
Required fields are marked with *
