Recombinant NRG4 Protein, GST-tagged
| Cat.No. : | NRG4-167 |
| Product Overview : | Recombinant NRG4 fused with GST tag at N-terminal was produced in E. coli. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E.coli |
| Tag : | GST |
| Form : | 50 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, pH 7.5 |
| Molecular Mass : | The theory of molecular size: about 6.8 KD. (About 32 KD with GST tag) |
| AA sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF |
| ◆ Recombinant Proteins | ||
| NRG4-2472H | Recombinant human NRG4, His-tagged | +Inquiry |
| NRG4-167 | Recombinant NRG4 Protein, GST-tagged | +Inquiry |
| NRG4-1021H | Active Recombinant Human NRG4 Protein, Tag Free | +Inquiry |
| NRG4-09H | Recombinant Human NRG4 Protein | +Inquiry |
| Nrg4-12M | Recombinant Mouse neuregulin 4 Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NRG4-1221HCL | Recombinant Human NRG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRG4 Products
Required fields are marked with *
My Review for All NRG4 Products
Required fields are marked with *
