Recombinant NRG4 Protein, GST-tagged
Cat.No. : | NRG4-167 |
Product Overview : | Recombinant NRG4 fused with GST tag at N-terminal was produced in E. coli. |
Availability | September 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Tag : | GST |
Form : | 50 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, pH 7.5 |
Molecular Mass : | The theory of molecular size: about 6.8 KD. (About 32 KD with GST tag) |
AA sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF |
◆ Recombinant Proteins | ||
NRG4-10888M | Recombinant Mouse NRG4 Protein | +Inquiry |
NRG4-365H | Recombinant Human NRG4 Protein, His/GST-tagged | +Inquiry |
NRG4-09H | Recombinant Human NRG4 Protein | +Inquiry |
NRG4-4042H | Recombinant Human NRG4 protein, SUMO&His-tagged | +Inquiry |
NRG4-1365H | Recombinant Human NRG4 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
NRG4-1021H | Active Recombinant Human NRG4 Protein, Tag Free | +Inquiry |
NRG4-15H | Active Recombinant Human NRG4 Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRG4-1221HCL | Recombinant Human NRG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRG4 Products
Required fields are marked with *
My Review for All NRG4 Products
Required fields are marked with *