Recombinant Mouse Nf2 protein, His-Trx-tagged
Cat.No. : | Nf2-3274M |
Product Overview : | Recombinant Mouse Nf2 protein(P46662)(1-320aa), fused to N-terminal His-Trx tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Trx |
Protein Length : | 1-320aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 55.9 kDa |
AA Sequence : | MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQ |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Nf2 neurofibromatosis 2 [ Mus musculus ] |
Official Symbol | Nf2 |
Synonyms | NF2; neurofibromatosis 2; merlin; schwannomin; neurofibromin-2; moesin-ezrin-radixin-like protein; |
Gene ID | 18016 |
mRNA Refseq | NM_001252250 |
Protein Refseq | NP_001239179 |
◆ Recombinant Proteins | ||
NF2-001H | Recombinant Human NF2 Protein, His-tagged | +Inquiry |
NF2-840H | Recombinant Human NF2 | +Inquiry |
NF2-6067C | Recombinant Chicken NF2 | +Inquiry |
NF2-3617H | Recombinant Human NF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NF2-6029M | Recombinant Mouse NF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NF2-3862HCL | Recombinant Human NF2 293 Cell Lysate | +Inquiry |
NF2-3861HCL | Recombinant Human NF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Nf2 Products
Required fields are marked with *
My Review for All Nf2 Products
Required fields are marked with *