Recombinant Mouse Nkx3-2 protein

Cat.No. : Nkx3-2-3278M
Product Overview : Recombinant Mouse Nkx3-2 protein(P97503)(1-333aa) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 1-333aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 35.2 kDa
AA Sequence : MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Nkx3-2 NK3 homeobox 2 [ Mus musculus ]
Official Symbol Nkx3-2
Synonyms NKX3-2; NK3 homeobox 2; homeobox protein Nkx-3.2; homeodomain protein Nkx-3.2; bagpipe homeobox gene 1 homolog; homeobox protein NK-3 homolog B; bagpipe homeobox protein homolog 1; Bapx1; NKX3.2; Nkx-3.2;
Gene ID 12020
mRNA Refseq NM_007524
Protein Refseq NP_031550

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Nkx3-2 Products

Required fields are marked with *

My Review for All Nkx3-2 Products

Required fields are marked with *

0
cart-icon
0
compare icon