Recombinant Mouse Nkx3-2 protein
| Cat.No. : | Nkx3-2-3278M |
| Product Overview : | Recombinant Mouse Nkx3-2 protein(P97503)(1-333aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 1-333aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 35.2 kDa |
| AA Sequence : | MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Nkx3-2 NK3 homeobox 2 [ Mus musculus ] |
| Official Symbol | Nkx3-2 |
| Synonyms | NKX3-2; NK3 homeobox 2; homeobox protein Nkx-3.2; homeodomain protein Nkx-3.2; bagpipe homeobox gene 1 homolog; homeobox protein NK-3 homolog B; bagpipe homeobox protein homolog 1; Bapx1; NKX3.2; Nkx-3.2; |
| Gene ID | 12020 |
| mRNA Refseq | NM_007524 |
| Protein Refseq | NP_031550 |
| ◆ Recombinant Proteins | ||
| Nkx3-2-690M | Recombinant Mouse Nkx3-2 Protein, MYC/DDK-tagged | +Inquiry |
| Nkx3-2-3278M | Recombinant Mouse Nkx3-2 protein | +Inquiry |
| Nkx3-2-1295H | Recombinant Human Nkx3-2 Protein, His/MYC-tagged | +Inquiry |
| NKX3-2-5713C | Recombinant Chicken NKX3-2 | +Inquiry |
| NKX3-2-073H | Recombinant Human NKX3-2 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Nkx3-2 Products
Required fields are marked with *
My Review for All Nkx3-2 Products
Required fields are marked with *
