Recombinant Mouse Nkx3-2 protein
Cat.No. : | Nkx3-2-3278M |
Product Overview : | Recombinant Mouse Nkx3-2 protein(P97503)(1-333aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-333aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.2 kDa |
AA Sequence : | MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Nkx3-2 NK3 homeobox 2 [ Mus musculus ] |
Official Symbol | Nkx3-2 |
Synonyms | NKX3-2; NK3 homeobox 2; homeobox protein Nkx-3.2; homeodomain protein Nkx-3.2; bagpipe homeobox gene 1 homolog; homeobox protein NK-3 homolog B; bagpipe homeobox protein homolog 1; Bapx1; NKX3.2; Nkx-3.2; |
Gene ID | 12020 |
mRNA Refseq | NM_007524 |
Protein Refseq | NP_031550 |
◆ Recombinant Proteins | ||
NKX3-2-073H | Recombinant Human NKX3-2 protein, GST-tagged | +Inquiry |
NKX3-2-215H | Recombinant Human NKX3-2 protein, His-tagged | +Inquiry |
NKX3-2-2857R | Recombinant Rhesus Macaque NKX3-2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NKX3-2-2159M | Recombinant Mouse NKX3-2 Protein (1-333 aa), His-SUMO-tagged | +Inquiry |
NKX3-2-5713C | Recombinant Chicken NKX3-2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Nkx3-2 Products
Required fields are marked with *
My Review for All Nkx3-2 Products
Required fields are marked with *