Recombinant Mouse NRL Protein (1-237 aa), His-SUMO-Myc-tagged
Cat.No. : | NRL-2535M |
Product Overview : | Recombinant Mouse NRL Protein (1-237 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 1-237 aa |
Description : | Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B. Functions also as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3. Binds in a sequence-specific manner to the rhodopsin promoter. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 46.1 kDa |
AA Sequence : | MAFPPSPLAMEYVNDFDLMKFEIKREPSEGRSGVPTASLGSTPYSSVPPSPTFSEPGMVGGGEAPRPGLEELYWLATLQQQLGSDEVLGLSPDEAVELLQNQGPVSMEGPLGYYSGSPGETGAQHVQLPERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSGGPGSDDHTHLFL |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Nrl neural retina leucine zipper gene [ Mus musculus ] |
Official Symbol | NRL |
Synonyms | NRL; neural retina leucine zipper gene; AW492574; D14H14S46E; |
Gene ID | 18185 |
mRNA Refseq | NM_001136074 |
Protein Refseq | NP_001129546 |
UniProt ID | P54846 |
◆ Recombinant Proteins | ||
NRL-3683H | Recombinant Human NRL Protein, His (Fc)-Avi-tagged | +Inquiry |
NRL-3293H | Recombinant Human NRL protein, His&Myc-tagged | +Inquiry |
NRL-1368H | Recombinant Human NRL, GST-tagged | +Inquiry |
NRL-2535M | Recombinant Mouse NRL Protein (1-237 aa), His-SUMO-Myc-tagged | +Inquiry |
NRL-10894M | Recombinant Mouse NRL Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRL-3693HCL | Recombinant Human NRL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NRL Products
Required fields are marked with *
My Review for All NRL Products
Required fields are marked with *
0
Inquiry Basket