Recombinant Mouse OTC Protein (33-354 aa), His-SUMO-tagged
Cat.No. : | OTC-705M |
Product Overview : | Recombinant Mouse OTC Protein (33-354 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 33-354 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 52.1 kDa |
AA Sequence : | SQVQLKGRDLLTLKNFTGEEIQYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPSFLTTQDIHLGVNESLTDTARVLSSMTDAVLARVYKQSDLDTLAKEASIPIVNGLSDLYHPIQILADYLTLQEHYGSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDPNIVKLAEQYAKENGTKLSMTNDPLEAARGGNVLITDTWISMGQEDEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPVLQKPKF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Otc ornithine transcarbamylase [ Mus musculus ] |
Official Symbol | OTC |
Synonyms | OTC; OTCase; sparse fur; Sf; spf; AI265390; |
Gene ID | 18416 |
mRNA Refseq | NM_008769 |
Protein Refseq | NP_032795 |
UniProt ID | P11725 |
◆ Recombinant Proteins | ||
OTC-6425M | Recombinant Mouse OTC Protein, His (Fc)-Avi-tagged | +Inquiry |
OTC-3309H | Recombinant Human OTC protein, His-SUMO-tagged | +Inquiry |
OTC-4215R | Recombinant Rat OTC Protein | +Inquiry |
OTC-1475H | Recombinant Human OTC protein, His-tagged | +Inquiry |
OTC-6720H | Recombinant Human OTC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OTC Products
Required fields are marked with *
My Review for All OTC Products
Required fields are marked with *