Recombinant Mouse P2ry1 Full Length Transmembrane protein, His-tagged
| Cat.No. : | P2ry1-0496M |
| Product Overview : | Recombinant Mouse P2ry1 protein(P49650)(1-373aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-373aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 48.3 kDa |
| AA Sequence : | MTEVPWSVVPNGTDAAFLAGLGSLWGNSTVASTAAVSSSFQCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAIYVSVLVWLIVVVAISPILFYSGTGTRKNKTVTCYDTTSNDYLRSYFIYSMCTTVAMFCIPLVLILGCYGLIVKALIYNDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPEMCDFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEEMTLNILSEFKQNGDTSL |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | P2ry1 purinergic receptor P2Y, G-protein coupled 1 [ Mus musculus ] |
| Official Symbol | P2ry1 |
| Synonyms | P2RY1; purinergic receptor P2Y, G-protein coupled 1; P2Y purinoceptor 1; ATP receptor; P2Y1 receptor; P2Y1; |
| Gene ID | 18441 |
| mRNA Refseq | NM_008772 |
| Protein Refseq | NP_032798 |
| ◆ Recombinant Proteins | ||
| P2RY1-12272M | Recombinant Mouse P2RY1 Protein | +Inquiry |
| P2RY1-3895R | Recombinant Rat P2RY1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| P2RY1-0969H | Recombinant Human P2RY1 Protein (T2-L373), Flag, His tagged | +Inquiry |
| RFL35980GF | Recombinant Full Length Chicken P2Y Purinoceptor 1(P2Ry1) Protein, His-Tagged | +Inquiry |
| P2RY1-4233R | Recombinant Rat P2RY1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| P2RY1-1267HCL | Recombinant Human P2RY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All P2ry1 Products
Required fields are marked with *
My Review for All P2ry1 Products
Required fields are marked with *
