Recombinant Mouse Pcnt protein, His&Myc-tagged
Cat.No. : | Pcnt-3322M |
Product Overview : | Recombinant Mouse Pcnt protein(P48725)(2545-2810aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2545-2810aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.7 kDa |
AA Sequence : | LCAAGLLTSFTNHTVDRTIKDWTSSNEKAVSSLMRTLEELKSELSMPTSFQKKMTAELQVQLMNELLSDNDALTKAVGMATREKAELCRTVSRLEKTLKHHTQKGCVLNRQSKSSLKQDGTDLQSSLRHSDPEWHSQTTSGDTNTCNIKMEKLYLHYLRAESFRKALIYQKKYLLLLIGGFQDSEQETLSMIAHLGVFPSKADKKITMSRPFTKFRTAVRVVIAVLRLRFLVKKWQEVDRKGALVHPKSTRHGHRTSQRQRSPSGP |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Pcnt pericentrin (kendrin) [ Mus musculus ] |
Official Symbol | Pcnt |
Synonyms | PCNT; pericentrin (kendrin); pericentrin; pericentrin 2; pericentrin-250; pericentrin-360; KEN; Pcnt2; C86676; kendrin; m239Asp; m275Asp; AW476095; |
Gene ID | 18541 |
mRNA Refseq | NM_008787 |
Protein Refseq | NP_032813 |
◆ Recombinant Proteins | ||
Pcnt-1928M | Recombinant Mouse Pcnt Protein, His-tagged | +Inquiry |
Pcnt-3322M | Recombinant Mouse Pcnt protein, His&Myc-tagged | +Inquiry |
PCNT-045H | Recombinant Human pericentrin Protein, His tagged | +Inquiry |
PCNT-8024H | Recombinant Human PCNT protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pcnt Products
Required fields are marked with *
My Review for All Pcnt Products
Required fields are marked with *