Recombinant Mouse Pglyrp1 protein, His&Myc-tagged
| Cat.No. : | Pglyrp1-3335M |
| Product Overview : | Recombinant Mouse Pglyrp1 protein(O88593)(19-182aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 19-182aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 26.2 kDa |
| AA Sequence : | FIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Pglyrp1 peptidoglycan recognition protein 1 [ Mus musculus ] |
| Official Symbol | Pglyrp1 |
| Synonyms | PGLYRP1; peptidoglycan recognition protein 1; cytokine tag7; PGRP; Tag7; Tasg7; PGRP-S; Pglyrp; Tnfsf3l; |
| Gene ID | 21946 |
| mRNA Refseq | NM_009402 |
| Protein Refseq | NP_033428 |
| ◆ Recombinant Proteins | ||
| PGLYRP1-164HFL | Recombinant Full Length Human PGLYRP1 Protein, C-Flag-tagged | +Inquiry |
| PGLYRP1-3334H | Recombinant Human PGLYRP1 protein, His&Myc-tagged | +Inquiry |
| Pglyrp1-6667M | Recombinant Mouse Pglyrp1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PGLYRP1-1661H | Recombinant Human PGLYRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Pglyrp1-570M | Active Recombinant Mouse Pglyrp1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PGLYRP1-1873MCL | Recombinant Mouse PGLYRP1 cell lysate | +Inquiry |
| PGLYRP1-1339HCL | Recombinant Human PGLYRP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pglyrp1 Products
Required fields are marked with *
My Review for All Pglyrp1 Products
Required fields are marked with *
