Recombinant Mouse Pla2g5 Protein, His-SUMO-tagged
Cat.No. : | Pla2g5-1412M |
Product Overview : | Recombinant Mouse Pla2g5 Protein (21-137aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 21-137 a.a. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 29.8kDa |
AA Sequence : | GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRCYGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRRNLWTYNPLYQYYPNFLC |
Purity : | > 90% as determined by SDS-PAGE. |
Storage : | Store at -20 centigrade/-80 centigrade. Repeated freezing and thawing is not recommended. |
Gene Name | Pla2g5 phospholipase A2, group V [ Mus musculus (house mouse) ] |
Official Symbol | Pla2g5 |
Synonyms | PLA2; sPLA2; Group V phospholipase A2; PLA2-10Phosphatidylcholine 2-acylhydrolase 5 |
Gene ID | 18784 |
mRNA Refseq | NM_001122954.1 |
Protein Refseq | NP_001116426.1 |
UniProt ID | P97391 |
◆ Recombinant Proteins | ||
PLA2G5-44H | Recombinant Human PLA2G5 Protein | +Inquiry |
PLA2G5-161H | Recombinant Human PLA2G5 Protein | +Inquiry |
PLA2G5-31349TH | Recombinant Human PLA2G5, His-tagged | +Inquiry |
PLA2G5-722R | Recombinant Rat PLA2G5 Protein (21-137 aa), His-SUMO-tagged | +Inquiry |
PLA2G5-12900M | Recombinant Mouse PLA2G5 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pla2g5 Products
Required fields are marked with *
My Review for All Pla2g5 Products
Required fields are marked with *
0
Inquiry Basket