Recombinant Mouse Ppia Protein, His-tagged

Cat.No. : Ppia-7385M
Product Overview : Recombinant mouse ppiA, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-164
Description : PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Form : Liquid
Molecular Mass : 20.4 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : In Phosphate buffered saline (pH7.4) containing 10 % glycerol, 1 mM DTT.
Gene Name Ppia peptidylprolyl isomerase A [ Mus musculus (house mouse) ]
Official Symbol Ppia
Synonyms Ppia; peptidylprolyl isomerase A; Cp; Cy; Cphn; CypA; SP18; CyP-1; CyP-18; peptidyl-prolyl cis-trans isomerase A; PPIase A; cyclophilin A; cyclosporin A-binding protein; rotamase A; EC 5.2.1.8
Gene ID 268373
mRNA Refseq NM_008907
Protein Refseq NP_032933
UniProt ID P17742

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ppia Products

Required fields are marked with *

My Review for All Ppia Products

Required fields are marked with *

0
cart-icon