Recombinant Mouse Ppia Protein, His-tagged
Cat.No. : | Ppia-7385M |
Product Overview : | Recombinant mouse ppiA, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-164 |
Description : | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. |
Form : | Liquid |
Molecular Mass : | 20.4 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | In Phosphate buffered saline (pH7.4) containing 10 % glycerol, 1 mM DTT. |
Gene Name | Ppia peptidylprolyl isomerase A [ Mus musculus (house mouse) ] |
Official Symbol | Ppia |
Synonyms | Ppia; peptidylprolyl isomerase A; Cp; Cy; Cphn; CypA; SP18; CyP-1; CyP-18; peptidyl-prolyl cis-trans isomerase A; PPIase A; cyclophilin A; cyclosporin A-binding protein; rotamase A; EC 5.2.1.8 |
Gene ID | 268373 |
mRNA Refseq | NM_008907 |
Protein Refseq | NP_032933 |
UniProt ID | P17742 |
◆ Recombinant Proteins | ||
PPIA-0216H | Recombinant Human PPIA Protein (M1-E165), Tag Free | +Inquiry |
Ppia-7385M | Recombinant Mouse Ppia Protein, His-tagged | +Inquiry |
PPIA-22H | Recombinant Full Length Human PPIA protein, GST-tagged | +Inquiry |
PPIA-3361R | Recombinant Rhesus Macaque PPIA Protein, His (Fc)-Avi-tagged | +Inquiry |
PPIA-4080H | Recombinant Human PPIA protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIA-2975HCL | Recombinant Human PPIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ppia Products
Required fields are marked with *
My Review for All Ppia Products
Required fields are marked with *