Recombinant Mouse Prkag1 protein, His-tagged
| Cat.No. : | Prkag1-4349M |
| Product Overview : | Recombinant Mouse Prkag1 protein(O54950)(1-330aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-330aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 41.6 kDa |
| AA Sequence : | MESVAAESSPALENEHFQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLQELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALVLTGGEKKP |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Prkag1 protein kinase, AMP-activated, gamma 1 non-catalytic subunit [ Mus musculus ] |
| Official Symbol | Prkag1 |
| Synonyms | PRKAG1; protein kinase, AMP-activated, gamma 1 non-catalytic subunit; 5-AMP-activated protein kinase subunit gamma-1; AMPKg; AMPK gamma1; AMPK subunit gamma-1; Prkaac; AA571379; BB036179; |
| Gene ID | 19082 |
| mRNA Refseq | NM_016781 |
| Protein Refseq | NP_058061 |
| ◆ Recombinant Proteins | ||
| PRKAG1-31763TH | Recombinant Human Human Human PRKAA1, His-tagged | +Inquiry |
| PRKAG1-5987H | Recombinant Human PRKAG1 Protein (Arg70-Leu300), N-His tagged | +Inquiry |
| PRKAG1-367H | Recombinant Human PRKAG1 protein, His/MBP-tagged | +Inquiry |
| PRKAG1-2793H | Recombinant Human PRKAG1 protein, His-tagged | +Inquiry |
| PRKAG1-2334H | Recombinant Human PRKAG1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRKAG1-2865HCL | Recombinant Human PRKAG1 293 Cell Lysate | +Inquiry |
| PRKAG1-2866HCL | Recombinant Human PRKAG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Prkag1 Products
Required fields are marked with *
My Review for All Prkag1 Products
Required fields are marked with *
