Recombinant Mouse Ins1 protein, GST-tagged
| Cat.No. : | Ins1-3730M |
| Product Overview : | Recombinant Mouse Ins1 protein(25-85 aa), fused to GST tag, was expressed in E. coli. |
| Availability | January 17, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 25-85 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | Ins1 insulin I [ Mus musculus ] |
| Official Symbol | Ins1 |
| Synonyms | INS1; insulin I; insulin-1; Ins-1; Ins2-rs1; |
| Gene ID | 16333 |
| mRNA Refseq | NM_008386 |
| Protein Refseq | NP_032412 |
| ◆ Recombinant Proteins | ||
| INS1-2436R | Recombinant Rat INS1 Protein (25-54 aa), His-SUMO-tagged | +Inquiry |
| RFL19133SF | Recombinant Full Length Schizosaccharomyces Pombe Insig Family Protein(Ins1) Protein, His-Tagged | +Inquiry |
| INS1-63M | Recombinant Mouse INS1 Protein, His/Myc-tagged | +Inquiry |
| INS1-8233M | Recombinant Mouse INS1 Protein | +Inquiry |
| INS1-2164M | Recombinant Mouse INS1 Protein (25-108 aa), His-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ins1 Products
Required fields are marked with *
My Review for All Ins1 Products
Required fields are marked with *
