Recombinant Mouse PROK1 protein

Cat.No. : PROK1-13430M
Product Overview : Recombinant Mouse PROK1 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 86
Description : The protein encoded by this gene induces proliferation, migration, and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. It has little or no effect on a variety of other endothelial and non-endothelial cell types. Its expression is restricted to the steroidogenic glands (ovary, testis, adrenal, and placenta), is induced by hypoxia, and often complementary to the expression of vascular endothelial growth factor (VEGF), suggesting that these molecules function in a coordinated manner.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH7.4, with 3 % Trehalose.
Bio-activity : Fully biologically active when compared to standard. The ED50 as Measured in a cell proliferation assay using EJG bovine adrenal-derived endothelial cells.
Molecular Mass : Approximately 9.6 kDa, a single non-glycosylated polypeptide chain containing 86 amino acids.
AA Sequence : AVITGACERDIQCGAGTCCAISLWLRGLRLCTPLGREGEECHPGSHKIPFLRKRQHHTCPCSPSLLCSRFPDGRYRCFRDLKNANF
Endotoxin : Less than 0.1 EU/µg of rMuEG-VEGF as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name PROK1
Official Symbol PROK1
Synonyms PROK1; prokineticin 1; prokineticin-1; endocrine-gland-derived vascular endothelial growth factor; EG-VEGF;
Gene ID 246691
mRNA Refseq NM_001044382
Protein Refseq NP_001037847
UniProt ID Q14A28

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PROK1 Products

Required fields are marked with *

My Review for All PROK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon