Recombinant Mouse Prolactin / Prl Protein

Cat.No. : Prl-001M
Product Overview : Recombinant mouse Prolactin protein (30-228aa) without tag, was expressed in E.coli and purified by using conventional chromatography techniques.
Availability July 04, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 30-228 a.a.
Description : Prolactin, also known as prl, is a hormone synthesized and secreted by lactotrope cells in the adenohypophysis (anterior pituitary gland). Prolactin has many effects, the most significant of which is to stimulate the mammary glands to produce milk (lactation). Increased serum prolactin during pregnancy causes enlargement of the mammary glands of the breasts and increases the production of milk. Recently, prolactin has demonstrated broader roles in breast cancer development, regulation of reproductive function, and immuno-regulation.
Form : Liquid
Molecular Mass : 22.7 kDa
Endotoxin : < 1.0 EU per 1 μg of protein (determined by LAL method)
Purity : > 90% by SDS - PAGE
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1.0 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate buffered saline (pH 7.4)
Warning : For research use only. This product is not intended or approved for human, diagnostics or veterin
AA Sequence : MQPLPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC
Gene Name Prl prolactin [ Mus musculus (house mouse) ]
Official Symbol Prl
Synonyms Prl; prolactin; Gha1; Prl1a1; AV290867; prolactin; growth hormone a1
Gene ID 19109
mRNA Refseq NM_011164
Protein Refseq NP_035294
UniProt ID Q9CPQ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Prl Products

Required fields are marked with *

My Review for All Prl Products

Required fields are marked with *

0
cart-icon