Recombinant Mouse Prom1 protein, His-SUMO-tagged
| Cat.No. : | Prom1-3371M |
| Product Overview : | Recombinant Mouse Prom1 protein(O54990)(509-794aa), fused to N-terminal 6XHis-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 509-794aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 48.5 kDa |
| AA Sequence : | GANVEKLLCEPYENKKLLQVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENVVNVSDHFNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLKETEKSPTEVNLLTFASTLEAKANQLPEGKPKQAFLLDVQNIRAIHQHLLPPVQQSLNTLRQSVWTLQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYLHWVFYAITEKMTSCKPMATAMDSAVNGILCGYVADPLN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Prom1 prominin 1 [ Mus musculus ] |
| Official Symbol | Prom1 |
| Synonyms | PROM1; prominin 1; prominin-1; prominin-like 1; antigen AC133 homolog; prominin-like protein 1; Prom; AC133; CD133; Prom-1; Proml1; 4932416E19Rik; |
| Gene ID | 19126 |
| mRNA Refseq | NM_001163577 |
| Protein Refseq | NP_001157049 |
| ◆ Recombinant Proteins | ||
| Prom1-120RAF555 | Recombinant Rat Prom1 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| PROM1-5907H | Active Recombinant Human PROM1 protein, His-tagged(Detergent) | +Inquiry |
| PROM1-7072H | Recombinant Human PROM1 protein, His-tagged | +Inquiry |
| Prom1-5140M | Recombinant Mouse Prom1 Protein, Myc/DDK-tagged | +Inquiry |
| PROM1-3619R | Recombinant Rhesus monkey PROM1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PROM1-981RCL | Recombinant Rat PROM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Prom1 Products
Required fields are marked with *
My Review for All Prom1 Products
Required fields are marked with *
