Species : |
Mouse |
Source : |
E.coli |
Tag : |
His&Myc |
Description : |
Predicted to enable cell adhesion molecule binding activity. Acts upstream of or within several processes, including animal organ development; axis elongation; and morphogenesis of an epithelium. Located in cell-cell junction and plasma membrane. Is expressed in several structures, including alimentary system; nervous system; paraxial mesenchyme; reproductive system; and sensory organ. Orthologous to human PTK7 (protein tyrosine kinase 7 (inactive)). |
Molecular Mass : |
79 kDa |
AA Sequence : |
AVDRLQDSGAFQCVARDNVTGEEVRSTNASFNIKWIEAGPVVLKHPASEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDDQSTHTVSSRERNLTLRPASPEHSGLYSCCAHNAFGQACSSQNFTLSVADESFARVVLAPQDVVVARNEEAMFHCQFSAQPPPSLQWVFEDETPITNRSRPPHLRRAVVFANGSLLLTQVRPRNAGVYRCIGQGQRGPPIVLEATLHLAEIEDMLPFEPRVFIAGDEERVTCPAPQGLPTPSVWWEHAGVPLPAHGRVHQKGLELVFVTIAESDTGVYTCHASNLAGQRRQDVNITVATVPTWLRKPQDSQLEEGKPGYLHCLTQATPKPTVIWYRNQMLISEDSRFEVSKNGTLRINSVEVYDGTLYRCVSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSATGREKPTVKWVRADGSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNEPQGQIRAHVQLTVAVFITFKVEPERTTVYQGHTALLRCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSGSYTCIAGNSCNIRHTEAPLLVVDKPVMEDSEGPGSPPPYKMIQT |
Endotoxin : |
< 1.0 EU/μg of the protein as determined by the LAL method. |
Purity : |
> 90% by SDS-PAGE |
Stability : |
Samples are stable for up to twelve months from date of receipt at -70 centigrade. |
Storage : |
Store it under sterile conditions at -20 to -70 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : |
Lyophilized from sterile 20mM Tris-HCl, 500mM NaCl, pH8.0. |
Reconstitution : |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 μg/μL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents. |