Recombinant Mouse PTK7 Protein, His and Myc tagged

• Cat.No.: PTK7-13660M
• Product Overview: Recombinant Mouse PTK7 Protein with His and Myc tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Description: Predicted to enable cell adhesion molecule binding activity. Acts upstream of or within several processes, including animal organ development; axis elongation; and morphogenesis of an epithelium. Located in cell-cell junction and plasma membrane. Is expressed in several structures, including alimentary system; nervous system; paraxial mesenchyme; reproductive system; and sensory organ. Orthologous to human PTK7 (protein tyrosine kinase 7 (inactive)).
• Molecular Mass: 79 kDa
• AA Sequence: AVDRLQDSGAFQCVARDNVTGEEVRSTNASFNIKWIEAGPVVLKHPASEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDDQSTHTVSSRERNLTLRPASPEHSGLYSCCAHNAFGQACSSQNFTLSVADESFARVVLAPQDVVVARNEEAMFHCQFSAQPPPSLQWVFEDETPITNRSRPPHLRRAVVFANGSLLLTQVRPRNAGVYRCIGQGQRGPPIVLEATLHLAEIEDMLPFEPRVFIAGDEERVTCPAPQGLPTPSVWWEHAGVPLPAHGRVHQKGLELVFVTIAESDTGVYTCHASNLAGQRRQDVNITVATVPTWLRKPQDSQLEEGKPGYLHCLTQATPKPTVIWYRNQMLISEDSRFEVSKNGTLRINSVEVYDGTLYRCVSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSATGREKPTVKWVRADGSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNEPQGQIRAHVQLTVAVFITFKVEPERTTVYQGHTALLRCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSGSYTCIAGNSCNIRHTEAPLLVVDKPVMEDSEGPGSPPPYKMIQT
• Endotoxin: < 1.0 EU/μg of the protein as determined by the LAL method.
• Purity: > 90% by SDS-PAGE
• Stability: Samples are stable for up to twelve months from date of receipt at -70 centigrade.
• Storage: Store it under sterile conditions at -20 to -70 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Lyophilized from sterile 20mM Tris-HCl, 500mM NaCl, pH8.0.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 μg/μL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents.

Gene Information

• Gene Name: Ptk7 PTK7 protein tyrosine kinase 7 [ Mus musculus (house mouse) ]
• Official Symbol: PTK7
• Synonyms: PTK7; PTK7 protein tyrosine kinase 7; inactive tyrosine-protein kinase 7; protein chuzhoi; protein-tyrosine kinase 7; tyrosine-protein kinase-like 7; pseudo tyrosine kinase receptor 7; receptor tyrosine kinase-like protein; chz; mPTK7/CCK4; 8430404F20Rik
• Gene ID: 71461
• mRNA Refseq: NM_175168
• Protein Refseq: NP_780377