Recombinant Mouse PTK7 Protein, His and Myc tagged

Cat.No. : PTK7-13660M
Product Overview : Recombinant Mouse PTK7 Protein with His and Myc tag was expressed in E. coli.
Availability December 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Description : Predicted to enable cell adhesion molecule binding activity. Acts upstream of or within several processes, including animal organ development; axis elongation; and morphogenesis of an epithelium. Located in cell-cell junction and plasma membrane. Is expressed in several structures, including alimentary system; nervous system; paraxial mesenchyme; reproductive system; and sensory organ. Orthologous to human PTK7 (protein tyrosine kinase 7 (inactive)).
Molecular Mass : 79 kDa
AA Sequence : AVDRLQDSGAFQCVARDNVTGEEVRSTNASFNIKWIEAGPVVLKHPASEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDDQSTHTVSSRERNLTLRPASPEHSGLYSCCAHNAFGQACSSQNFTLSVADESFARVVLAPQDVVVARNEEAMFHCQFSAQPPPSLQWVFEDETPITNRSRPPHLRRAVVFANGSLLLTQVRPRNAGVYRCIGQGQRGPPIVLEATLHLAEIEDMLPFEPRVFIAGDEERVTCPAPQGLPTPSVWWEHAGVPLPAHGRVHQKGLELVFVTIAESDTGVYTCHASNLAGQRRQDVNITVATVPTWLRKPQDSQLEEGKPGYLHCLTQATPKPTVIWYRNQMLISEDSRFEVSKNGTLRINSVEVYDGTLYRCVSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSATGREKPTVKWVRADGSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNEPQGQIRAHVQLTVAVFITFKVEPERTTVYQGHTALLRCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSGSYTCIAGNSCNIRHTEAPLLVVDKPVMEDSEGPGSPPPYKMIQT
Endotoxin : < 1.0 EU/μg of the protein as determined by the LAL method.
Purity : > 90% by SDS-PAGE
Stability : Samples are stable for up to twelve months from date of receipt at -70 centigrade.
Storage : Store it under sterile conditions at -20 to -70 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Lyophilized from sterile 20mM Tris-HCl, 500mM NaCl, pH8.0.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 μg/μL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents.
Gene Name Ptk7 PTK7 protein tyrosine kinase 7 [ Mus musculus (house mouse) ]
Official Symbol PTK7
Synonyms PTK7; PTK7 protein tyrosine kinase 7; inactive tyrosine-protein kinase 7; protein chuzhoi; protein-tyrosine kinase 7; tyrosine-protein kinase-like 7; pseudo tyrosine kinase receptor 7; receptor tyrosine kinase-like protein; chz; mPTK7/CCK4; 8430404F20Rik;
Gene ID 71461
mRNA Refseq NM_175168
Protein Refseq NP_780377

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTK7 Products

Required fields are marked with *

My Review for All PTK7 Products

Required fields are marked with *

0
cart-icon
0
compare icon