Recombinant Mouse QPCT Protein (36-362 aa), His-tagged
| Cat.No. : | QPCT-2269M |
| Product Overview : | Recombinant Mouse QPCT Protein (36-362 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 36-362 aa |
| Description : | Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 39.6 kDa |
| AA Sequence : | AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Qpct glutaminyl-peptide cyclotransferase (glutaminyl cyclase) [ Mus musculus ] |
| Official Symbol | QPCT |
| Synonyms | QPCT; QC; glutaminyl cyclase; glutaminyl-tRNA cyclotransferase; 5730422A13Rik; |
| Gene ID | 70536 |
| mRNA Refseq | NM_027455 |
| Protein Refseq | NP_081731 |
| UniProt ID | Q9CYK2 |
| ◆ Recombinant Proteins | ||
| QPCT-3307H | Recombinant Human QPCT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| QPCT-1822H | Recombinant Human QPCT Protein, His (Fc)-Avi-tagged | +Inquiry |
| QPCT-7565H | Recombinant Human QPCT protein, His&Myc-tagged | +Inquiry |
| QPCT-2139M | Recombinant Mouse QPCT Protein (36-362 aa), His-tagged | +Inquiry |
| QPCT-1347H | Recombinant Human QPCT Protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| QPCT-001HCL | Recombinant Human QPCT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All QPCT Products
Required fields are marked with *
My Review for All QPCT Products
Required fields are marked with *
