Recombinant Mouse/Rat FGF1 Protein
Cat.No. : | FGF1-79M |
Product Overview : | Recombinant Mouse/Rat FGF1 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse/Rat |
Source : | E.coli |
Description : | Acidic fibroblast growth factor (FGF-acidic), also known as FGF-1, is a potent inducer of DNA synthesis, cell proliferation, and has chemotactic activities. FGF-acidic regulates cardiogenesis through protein kinase C signaling. FGF-acidic also functions as an insulin sensitizer and mediates adipose tissue remodeling. High serum levels of FGF-acidic are associated with type 2 diabetes mellitus (T2DM), suggesting a pathogenic role of FGF-acidic during T2DM. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 15.9 kDa (141 aa) |
AA Sequence : | MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 75 mM sodium chloride, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Fgf1 fibroblast growth factor 1 [ Mus musculus (house mouse) ] |
Official Symbol | FGF1 |
Synonyms | FGF1; fibroblast growth factor 1; aFGF; HBGF-1; acidic fibroblast growth factor; heparin-binding growth factor 1; fibroblast growth factor 1 (acidic); Fam; Fgfa; Dffrx; Fgf-1; |
Gene ID | 14164 |
mRNA Refseq | NM_010197 |
Protein Refseq | NP_034327 |
UniProt ID | P61148 |
◆ Native Proteins | ||
FGF1-26203TH | Native Human FGF1 | +Inquiry |
FGF1-33B | Active Native Bovine FGF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF1-6252HCL | Recombinant Human FGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF1 Products
Required fields are marked with *
My Review for All FGF1 Products
Required fields are marked with *