Recombinant Mouse Retnla Protein

Cat.No. : Retnla-5468M
Product Overview : Purified recombinant protein of Mouse resistin like alpha (cDNA clone MGC:35890 IMAGE:4189285) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Biased expression in mammary gland adult (RPKM 357.7), subcutaneous fat pad adult (RPKM 170.8) and 3 other tissues.
Molecular Mass : 10 kDa
AA Sequence : MDETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS
Endotoxin : < 0.1 ng/μg of protein (< 1 EU/μg)
Purity : > 95% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2
Gene Name Retnla resistin like alpha [ Mus musculus (house mouse) ]
Official Symbol Retnla
Synonyms RETNLA; resistin like alpha; resistin-like alpha; found in inflammatory zone 1; hypoxia-induced mitogenic factor; cysteine-rich secreted protein FIZZ1; cysteine-rich secreted protein A12-gamma; parasite-induced macrophage novel gene 1 protein; HIMF; Xcp2; Fizz1; RELMa; Fizz-1; RELMalpha; RELM-alpha; 1810019L16Rik
Gene ID 57262
mRNA Refseq NM_020509
Protein Refseq NP_065255

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Retnla Products

Required fields are marked with *

My Review for All Retnla Products

Required fields are marked with *

0
cart-icon
0
compare icon