Recombinant Mouse Retnla Protein

• Cat.No.: Retnla-5468M
• Product Overview: Purified recombinant protein of Mouse resistin like alpha (cDNA clone MGC:35890 IMAGE:4189285) without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Biased expression in mammary gland adult (RPKM 357.7), subcutaneous fat pad adult (RPKM 170.8) and 3 other tissues.
• Molecular Mass: 10 kDa
• AA Sequence: MDETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2

Gene Information

• Gene Name: Retnla resistin like alpha [ Mus musculus (house mouse) ]
• Official Symbol: Retnla
• Synonyms: RETNLA; resistin like alpha; resistin-like alpha; found in inflammatory zone 1; hypoxia-induced mitogenic factor; cysteine-rich secreted protein FIZZ1; cysteine-rich secreted protein A12-gamma; parasite-induced macrophage novel gene 1 protein; HIMF; Xcp2; Fizz1; RELMa; Fizz-1; RELMalpha; RELM-alpha; 1810019L16Rik
• Gene ID: 57262
• mRNA Refseq: NM_020509
• Protein Refseq: NP_065255