Recombinant Mouse Retnla Protein
Cat.No. : | Retnla-5468M |
Product Overview : | Purified recombinant protein of Mouse resistin like alpha (cDNA clone MGC:35890 IMAGE:4189285) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Biased expression in mammary gland adult (RPKM 357.7), subcutaneous fat pad adult (RPKM 170.8) and 3 other tissues. |
Molecular Mass : | 10 kDa |
AA Sequence : | MDETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Retnla resistin like alpha [ Mus musculus (house mouse) ] |
Official Symbol | Retnla |
Synonyms | RETNLA; resistin like alpha; resistin-like alpha; found in inflammatory zone 1; hypoxia-induced mitogenic factor; cysteine-rich secreted protein FIZZ1; cysteine-rich secreted protein A12-gamma; parasite-induced macrophage novel gene 1 protein; HIMF; Xcp2; Fizz1; RELMa; Fizz-1; RELMalpha; RELM-alpha; 1810019L16Rik |
Gene ID | 57262 |
mRNA Refseq | NM_020509 |
Protein Refseq | NP_065255 |
◆ Recombinant Proteins | ||
Retnla-3714M | Recombinant Human Retnla, Flag-tagged | +Inquiry |
Retnla-6849R | Recombinant Rat Retnla Protein (Met1-Ser111), C-Fc tagged | +Inquiry |
Retnla-4746M | Recombinant Mouse Resistin Like Alpha | +Inquiry |
RETNLA-4660R | Recombinant Rat RETNLA Protein, His (Fc)-Avi-tagged | +Inquiry |
Retnla-4156M | Recombinant Mouse Resistin Like Alpha, Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Retnla Products
Required fields are marked with *
My Review for All Retnla Products
Required fields are marked with *