Recombinant Mouse S100a10 Protein, His-tagged

Cat.No. : S100a10-7319M
Product Overview : Recombinant Mouse S100a10 protein with a His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-97
Description : Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.
Form : Liquid
Molecular Mass : 13.6 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFLSLVAGLTIACNDYFVVNMKQKGKK
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by bradford assay)
Storage Buffer : Phosphate buffered saline (pH 7.4) containing 10 % glycerol.
Gene Name S100a10 S100 calcium binding protein A10 (calpactin) [ Mus musculus (house mouse) ]
Official Symbol S100a10
Synonyms S100a10; S100 calcium binding protein A10 (calpactin); Ca; p1; 42C; CAL; CLP; p10; p11; CAL12; CLP11; Cal1l; AA409961; AL024248; protein S100-A10; S100 calcium binding protein A10 (calgizzarin); S100 calcium-binding protein A10; calcium binding protein A11 (calgizzarin); calpactin I light chain; calpactin-1 light chain; cellular ligand of annexin II
Gene ID 20194
mRNA Refseq NM_009112
Protein Refseq NP_033138
UniProt ID P08207

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100a10 Products

Required fields are marked with *

My Review for All S100a10 Products

Required fields are marked with *

0
cart-icon