Recombinant Mouse S100a10 Protein, His-tagged
Cat.No. : | S100a10-7319M |
Product Overview : | Recombinant Mouse S100a10 protein with a His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-97 |
Description : | Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase. |
Form : | Liquid |
Molecular Mass : | 13.6 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFLSLVAGLTIACNDYFVVNMKQKGKK |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by bradford assay) |
Storage Buffer : | Phosphate buffered saline (pH 7.4) containing 10 % glycerol. |
Gene Name | S100a10 S100 calcium binding protein A10 (calpactin) [ Mus musculus (house mouse) ] |
Official Symbol | S100a10 |
Synonyms | S100a10; S100 calcium binding protein A10 (calpactin); Ca; p1; 42C; CAL; CLP; p10; p11; CAL12; CLP11; Cal1l; AA409961; AL024248; protein S100-A10; S100 calcium binding protein A10 (calgizzarin); S100 calcium-binding protein A10; calcium binding protein A11 (calgizzarin); calpactin I light chain; calpactin-1 light chain; cellular ligand of annexin II |
Gene ID | 20194 |
mRNA Refseq | NM_009112 |
Protein Refseq | NP_033138 |
UniProt ID | P08207 |
◆ Recombinant Proteins | ||
S100A10-434H | Recombinant Human S100A10, His-tagged | +Inquiry |
S100A10-3458H | Recombinant Human S100A10 protein, His&Myc-tagged | +Inquiry |
S100A10-4021H | Recombinant Human S100A10 Protein, His (Fc)-Avi-tagged | +Inquiry |
S100a10-7319M | Recombinant Mouse S100a10 Protein, His-tagged | +Inquiry |
S100A10-6223H | Recombinant Human S100A10 Protein (Met1-Lys96), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A10-2096HCL | Recombinant Human S100A10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100a10 Products
Required fields are marked with *
My Review for All S100a10 Products
Required fields are marked with *
0
Inquiry Basket