Recombinant Mouse S100a10 Protein, His-tagged

• Cat.No.: S100a10-7319M
• Product Overview: Recombinant Mouse S100a10 protein with a His tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-97
• Description: Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.
• Form: Liquid
• Molecular Mass: 13.6 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFLSLVAGLTIACNDYFVVNMKQKGKK
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by bradford assay)
• Storage Buffer: Phosphate buffered saline (pH 7.4) containing 10 % glycerol.

Gene Information

• Gene Name: S100a10 S100 calcium binding protein A10 (calpactin) [ Mus musculus (house mouse) ]
• Official Symbol: S100a10
• Synonyms: S100a10; S100 calcium binding protein A10 (calpactin); Ca; p1; 42C; CAL; CLP; p10; p11; CAL12; CLP11; Cal1l; AA409961; AL024248; protein S100-A10; S100 calcium binding protein A10 (calgizzarin); S100 calcium-binding protein A10; calcium binding protein A11 (calgizzarin); calpactin I light chain; calpactin-1 light chain; cellular ligand of annexin II
• Gene ID: 20194
• mRNA Refseq: NM_009112
• Protein Refseq: NP_033138
• UniProt ID: P08207