Recombinant Mouse S100a6 Protein, His-tagged

Cat.No. : S100a6-7326M
Product Overview : Recombinant mouse S100A6 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-89
Description : May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.
Form : Liquid
Molecular Mass : 12.2 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK
Purity : > 95 %
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 1 mM DTT, 30 % glycerol, 100 mM NaCl
Gene Name S100a6 S100 calcium binding protein A6 (calcyclin) [ Mus musculus (house mouse) ]
Official Symbol S100a6
Synonyms S100a6; S100 calcium binding protein A6 (calcyclin); 2A; 2A9; Cac; PRA; 5B10; CALC; Cacy; CALCYCLIN; protein S100-A6; S100 calcium-binding protein A6; calcium binding protein A6 (calcyclin); prolactin receptor-associated protein
Gene ID 20200
mRNA Refseq NM_011313
Protein Refseq NP_035443
UniProt ID P14069

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100a6 Products

Required fields are marked with *

My Review for All S100a6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon