Recombinant Mouse S100a6 Protein, His-tagged
Cat.No. : | S100a6-7326M |
Product Overview : | Recombinant mouse S100A6 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-89 |
Description : | May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative. |
Form : | Liquid |
Molecular Mass : | 12.2 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK |
Purity : | > 95 % |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 1 mM DTT, 30 % glycerol, 100 mM NaCl |
Gene Name | S100a6 S100 calcium binding protein A6 (calcyclin) [ Mus musculus (house mouse) ] |
Official Symbol | S100a6 |
Synonyms | S100a6; S100 calcium binding protein A6 (calcyclin); 2A; 2A9; Cac; PRA; 5B10; CALC; Cacy; CALCYCLIN; protein S100-A6; S100 calcium-binding protein A6; calcium binding protein A6 (calcyclin); prolactin receptor-associated protein |
Gene ID | 20200 |
mRNA Refseq | NM_011313 |
Protein Refseq | NP_035443 |
UniProt ID | P14069 |
◆ Recombinant Proteins | ||
S100a6-845M | Recombinant Mouse S100 Calcium Binding Protein A6 (Calcyclin) | +Inquiry |
S100A6-4063R | Recombinant Rhesus monkey S100A6 Protein, His-tagged | +Inquiry |
S100A6-6216H | Recombinant Human S100A6 Protein (Met1-Gly90), His tagged | +Inquiry |
S100A6-3462H | Recombinant Human S100A6 protein, His-SUMO-tagged | +Inquiry |
S100A6-1773H | Recombinant Human S100A6 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
S100a6-43M | Native Mouse S100A6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A6-690HCL | Recombinant Human S100A6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100a6 Products
Required fields are marked with *
My Review for All S100a6 Products
Required fields are marked with *