"S100b" Related Products

Expand
Expand

Recombinant Mouse S100b protein, His-tagged

Cat.No.: S100b-2570M
Product Overview: Recombinant Mouse S100b(Met1-Glu92) fused with His tag at C-terminal was expressed in E. coli.
Source: E. coli
Species: Mouse
Tag: His
Form: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Protein length: Met1-Glu92
AA Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDG DGECDFQEFMAFVAMVTTACHEFFEHELEHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping: The product is shipped at ambient temperature.
Gene Name: S100b S100 protein, beta polypeptide, neural [ Mus musculus ]
Official Symbol: S100b
Synonyms: S100B; S100 protein, beta polypeptide, neural; protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; Bpb; AI850290; MGC74317;
Gene ID: 20203
mRNA Refseq: NM_009115
Protein Refseq: NP_033141
MIM:
UniProt ID:
Chromosome Location: 10 C1; 10 38.76 cM
Pathway: Activated TLR4 signalling, organism-specific biosystem; Cytosolic sensors of pathogen-associated DNA, organism-specific biosystem; DAI mediated induction of type I IFNs, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MyD88 cascade initiated on plasma membrane, organism-specific biosystem; MyD88 dependent cascade initiated on endosome, organism-specific biosystem;
Function: RAGE receptor binding; S100 beta binding; calcium ion binding; calcium ion binding; calcium-dependent protein binding; identical protein binding; metal ion binding; protein homodimerization activity; receptor binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.