Recombinant Mouse S100b protein, His-tagged

Cat.No. : S100b-2570M
Product Overview : Recombinant Mouse S100b(Met1-Glu92) fused with His tag at C-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : Met1-Glu92
Form : Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.
AA Sequence : MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDG DGECDFQEFMAFVAMVTTACHEFFEHELEHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Gene Name S100b S100 protein, beta polypeptide, neural [ Mus musculus ]
Official Symbol S100b
Synonyms S100B; S100 protein, beta polypeptide, neural; protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; Bpb; AI850290; MGC74317;
Gene ID 20203
mRNA Refseq NM_009115
Protein Refseq NP_033141
MIM
UniProt ID
Chromosome Location 10 C1; 10 38.76 cM
Pathway Activated TLR4 signalling, organism-specific biosystem; Cytosolic sensors of pathogen-associated DNA, organism-specific biosystem; DAI mediated induction of type I IFNs, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MyD88 cascade initiated on plasma membrane, organism-specific biosystem; MyD88 dependent cascade initiated on endosome, organism-specific biosystem;
Function RAGE receptor binding; S100 beta binding; calcium ion binding; calcium ion binding; calcium-dependent protein binding; identical protein binding; metal ion binding; protein homodimerization activity; receptor binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100b Products

Required fields are marked with *

My Review for All S100b Products

Required fields are marked with *

0
cart-icon
0
compare icon