Recombinant Mouse S100b protein, His-tagged
Cat.No. : | S100b-2570M |
Product Overview : | Recombinant Mouse S100b(Met1-Glu92) fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | Met1-Glu92 |
Form : | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4. |
AA Sequence : | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDG DGECDFQEFMAFVAMVTTACHEFFEHELEHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | S100b S100 protein, beta polypeptide, neural [ Mus musculus ] |
Official Symbol | S100b |
Synonyms | S100B; S100 protein, beta polypeptide, neural; protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; Bpb; AI850290; MGC74317; |
Gene ID | 20203 |
mRNA Refseq | NM_009115 |
Protein Refseq | NP_033141 |
MIM | |
UniProt ID | |
Chromosome Location | 10 C1; 10 38.76 cM |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Cytosolic sensors of pathogen-associated DNA, organism-specific biosystem; DAI mediated induction of type I IFNs, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MyD88 cascade initiated on plasma membrane, organism-specific biosystem; MyD88 dependent cascade initiated on endosome, organism-specific biosystem; |
Function | RAGE receptor binding; S100 beta binding; calcium ion binding; calcium ion binding; calcium-dependent protein binding; identical protein binding; metal ion binding; protein homodimerization activity; receptor binding; zinc ion binding; |
◆ Recombinant Proteins | ||
S100B-34H | Recombinant Full Length Human S100B protein | +Inquiry |
S100B-2724H | Recombinant Full Length Human S100B Protein, His-tagged | +Inquiry |
S100B-4571H | Recombinant Human S100 Calcium Binding Protein B, GST-tagged | +Inquiry |
S100B-374HFL | Recombinant Full Length Human S100B Protein, C-Flag-tagged | +Inquiry |
S100B-3882R | Recombinant Rhesus Macaque S100B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
S100B-257B | Native Bovine S-100b Protein | +Inquiry |
S100B-1116H | Native Human S100B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100B-2858HCL | Recombinant Human S100B cell lysate | +Inquiry |
S100B-1418MCL | Recombinant Mouse S100B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100b Products
Required fields are marked with *
My Review for All S100b Products
Required fields are marked with *
0
Inquiry Basket