"S100b" Related Products

Expand
Expand

Recombinant Mouse S100b protein, His-tagged

Cat.No.: S100b-2570M
Product Overview: Recombinant Mouse S100b(Met1-Glu92) fused with His tag at C-terminal was expressed in E. coli.
Source: E. coli
Species: Mouse
Tag: His
Form: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Protein length: Met1-Glu92
AA Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDG DGECDFQEFMAFVAMVTTACHEFFEHELEHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping: The product is shipped at ambient temperature.
Gene Name: S100b S100 protein, beta polypeptide, neural [ Mus musculus ]
Official Symbol: S100b
Synonyms: S100B; S100 protein, beta polypeptide, neural; protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; Bpb; AI850290; MGC74317;
Gene ID: 20203
mRNA Refseq: NM_009115
Protein Refseq: NP_033141
MIM:
UniProt ID:
Chromosome Location: 10 C1; 10 38.76 cM
Pathway: Activated TLR4 signalling, organism-specific biosystem; Cytosolic sensors of pathogen-associated DNA, organism-specific biosystem; DAI mediated induction of type I IFNs, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MyD88 cascade initiated on plasma membrane, organism-specific biosystem; MyD88 dependent cascade initiated on endosome, organism-specific biosystem;
Function: RAGE receptor binding; S100 beta binding; calcium ion binding; calcium ion binding; calcium-dependent protein binding; identical protein binding; metal ion binding; protein homodimerization activity; receptor binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.