Recombinant Mouse Saa3 Protein, His-tagged
| Cat.No. : | Saa3-1456M |
| Product Overview : | Recombinant Mouse Saa3(20-122aa) fused with His tag at N-terminal was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 20-122aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 13.8kDa |
| AA Sequence : | RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Saa3 serum amyloid A 3 [ Mus musculus ] |
| Official Symbol | Saa3 |
| Synonyms | l7R3; Saa-3; AV098916 |
| Gene ID | 20210 |
| mRNA Refseq | NM_011315 |
| Protein Refseq | NP_035445 |
| UniProt ID | P04918 |
| ◆ Recombinant Proteins | ||
| SAA3-7878M | Recombinant Mouse SAA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SAA3-14635M | Recombinant Mouse SAA3 Protein | +Inquiry |
| Saa3-1455M | Recombinant Mouse Saa3 Protein, His-tagged | +Inquiry |
| Saa3-1456M | Recombinant Mouse Saa3 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Saa3 Products
Required fields are marked with *
My Review for All Saa3 Products
Required fields are marked with *
